Identifiers and Description

Gene Model Identifier

Contig6982.0.g48

Standard Name

DDXH19

Aliases

Contig6982_0_g48

Description

Peptidyl-tRNA hydrolase PTH2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6982.0.g48(coding)
ATGGAATCTCATTAGATAAGCACTGACACAACCAATTCTTAATTCGAGCCAGACCCTCAA
GTAATTTTGGAGCTATGTGAGTTTGGTTTTGACTATGAAATGTGTTATTTAGCATTGTAA
ATATCTCAGAATGATAGAAATTAGGCAGTTGAGCTGCTCTGTAGTGGAGGGACAGATATA
GAAACAATGCGTGTATTGGCTCAAAGTGCTAGAATTATCAAAGATGAGGGAGGTCAGTAC
GATGAGAATCAGTTTGATAAGGACATTAAATAGGATGTAATGAGGGATTTGATTAAAGGA
ATCATTAGTGATTTGATGTTAGAAGAGCCAAAGTAAGCGAAATAAGTTGATTAATAGGAA
GAAAAAAAGCAGTAGAACTCAGATTTAATAGAAGAGTCAAAGCAGAAAAAGCTAGAATTT
AAGGTTAAAACTGAATAGGACTATCACAATGAAAGTAAAATGGTATTCGTATGGCGACAA
GATAAGGGGTTGAAGAACCTTCCAATTGGCGTTTCTGCTAAATATGCAGCAGAAGCGACA
TTAAAAGCTTTTCAAAGTGGTTTAAAAACAGACCCTGAAAGTGTCAATGAATGGGCAAGG
AAATGTGATGATGGGAGATATTTCTGGCCAAAGATCTCACTAAAATGCAAAGATGATAAA
GAGCTTTTGGAAATATAAAAACGAGCCGAGGAAGGTGGAATTAATCATTATATGCTTAGG
AAATCCATGATACTTCCCTATAAACCATAACAAAGTGTAAAAACTGACAGTAAAGATTAA
ACTAATGATAATTCGTAGAGTTAACAGATGGCAGATTAAATATAAGTAAATGATAAATAA
AAACCTTAAAAAATGAGTAAAGAGGAGAGAAAACAAAAAAGAGCTGGGAACTAGTAATAA
GAACAGCTGAAGGAAGAAATTATTTTGTTGATTGTTGGGCCAGCATTAAATGCCAAATTA
TAACCTGTAACTGGTAACCTTAAGCTTTTGTGA


>Contig6982.0.g48(protein)
MESHQISTDTTNSQFEPDPQVILELCEFGFDYEMCYLALQISQNDRNQAVELLCSGGTDI
ETMRVLAQSARIIKDEGGQYDENQFDKDIKQDVMRDLIKGIISDLMLEEPKQAKQVDQQE
EKKQQNSDLIEESKQKKLEFKVKTEQDYHNESKMVFVWRQDKGLKNLPIGVSAKYAAEAT
LKAFQSGLKTDPESVNEWARKCDDGRYFWPKISLKCKDDKELLEIQKRAEEGGINHYMLR
KSMILPYKPQQSVKTDSKDQTNDNSQSQQMADQIQVNDKQKPQKMSKEERKQKRAGNQQQ
EQLKEEIILLIVGPALNAKLQPVTGNLKLL