Identifiers and Description

Gene Model Identifier

Contig13110.0.0.g67

Standard Name

DDXH18

Aliases

Contig13110_0_0_g67

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007808002.9990241513684e-21Ras family protein
SGDYML001W1.000116773704384e-19YPT7 SGDID:S000004460, Chr XII
I from 267174-267800, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13110.0.0.g67(coding)
ATGGAAGACGATCGCCTAAAAATAAAGATAGTGGTCATAGGCGATGGGGGAGTGGGTAAA
TCAAGTTTCTGCTAAAAAATACTCATGGGGTAAAATTACAATCCTAATAACGATGAAAAT
CTATATAAGCCAACTATAGCATCTGATTTCTTCACAAGAGTGTTACAATTATAGAACTAG
AAGCATGTTTAATTGAATTTTTGGGATTTAAGCGGACATCCTGAGTTTTATCAGTAAAGG
CTAAGGTTTTACGGCGGTACTCACATTTTGATCTACATGTACGACCTGAGCTTCAAAGAC
AGTTTTGAGAATTTGAATGAATGGCACAGAGAATATATTACTGAAATGAATTCACACCCC
ATTCACACTTATATAATTGGAAATAAAGTTGAGAGATAGAGGGATAGATTCTTAGAACAG
TTTGAAATTGATAATTTTTGCAAAAATAAGGGTATTAAAGCGCATTTCAGTACAAGTGTC
TATGAAAGTAAATAAATTAAAGAACTTTAATGA


>Contig13110.0.0.g67(protein)
MEDDRLKIKIVVIGDGGVGKSSFCQKILMGQNYNPNNDENLYKPTIASDFFTRVLQLQNQ
KHVQLNFWDLSGHPEFYQQRLRFYGGTHILIYMYDLSFKDSFENLNEWHREYITEMNSHP
IHTYIIGNKVERQRDRFLEQFEIDNFCKNKGIKAHFSTSVYESKQIKELQ