Identifiers and Description

Gene Model Identifier

Contig20743.0.g34

Standard Name

DDXH17

Aliases

Contig20743_0_g34

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008255300.00000019998969434520019hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20743.0.g34(coding)
ATGTAAGATTAGTTGAGTTACAACATGCATCATGAATGGATTGAGAAAGACCAAGATATA
TTGCTATTATAAAACTTAATCAAATCTAGAAGCAATATATTTGTGTACGGAGCGCACGGT
TCTGGAAAGACCACTTTTGTAAAAGATTGCCTGGACAGTTTGGAATAATCTTCCTCCTCT
TTATCAGCTCAATCGCAGCAGCACATCTATCACATTTACATAGACTGCATAGAGTACTAC
TCTGAGAAGTTAATAGCAACCATGATTTCATTTCAGTTGAACTAAATTTTGCAGAAGTTT
GCAATTAGCAATTAATTGACTAAAACTCAAGCTAGAAAGTATCAAGTGAGATCGTGCAGA
AATTTTCCCATGCTAATGGATGCTATGCAAGGATTTTGCAGTTACTATGACAATGAAAAA
AATTCATCAGATTCGATCTTGAAGTCTGAATTTTTCTTCTACATAGTTTTAGATAACATC
TAGAATCTCTTAGAAATCGAGAGAACTAAGAAACTCCTCACAAAGCTCTGTGTTATTTAA
AGTTTGCTGACCCCTCAGTGCTTCAGTTTACTGGTGATAAATCATTGCTTGGTGCAAGAA
ATTGAAGTGCTTAAAGATCAGCAAGGTATCTTTGAAGAATACATGTTTACTTGCTTCTTT
TTCTTACCCATGGTAGAGAACCAAATTCATTCGATTCTACTTGAAAAGTTGAGAGTAAAA
TTTGGAACATAGCCGTATTTGGAGATAGCATTTGAAAAGATGTTCAATTAATTATTCTCT
GATATAAAATCCTATACAAGAAACATTAACGAATATGAGTACTATTTCACATTTCTGTAT
CCATCTTACATTGAACCACTGAAAAATCTGACTGACAAGGAAATCGATGCAAGATTATAA
AAACCACTTTCAAACAAGAATTTCTTAGGGCAGGAGAGGGAAGTGAAGAGCGCACTTTTT
ATGCATTATCAATCAATGGATGATGTGAAAAAGAACTTAGAGATGTAAATAGATTAAGAG
TTTTAGGAAAAGATTAAAGAATAGAATAAAGCTTAGAGATTTTAAAATCAAGAGATATTG
AAATAAAAAACTTTTGAAGTTCTAGTGATTAACTAATTAGAAAATTCCAAGAAAAATATG
AATTTCACCTACATGTAAAGTTTATGTTTAATTGCTGCCTATCTCGCAGGAGCGAATAAA
GAATGCATAGATTAAAGAATGTTCTAAAATCGCAGTATTAGCACAAGAAGTAAAAAGGGT
CTTACCAATGTAAAGTCTGATTAGTAAAAGCAGCCAGGCTAAGGATAGTTTATGCTTGGG
AAAACAAAGAAATTCTACTTTGAAAGATATGCAGGCATCATTGATTATTTAGTTTCTCTG
GTTGCAGAAGAGAGCAAGGAGAATTATTGCATTGGTAGATCACTTGATTATATAGCTTGT
ATCAATTCAATGTGTGAAGAAGGTTTAATCAAGAAAAGTACAATGAAGAAGGGTGCATCG
GGAGGTGGAGACGGTGGTGATGAATTGGTGAATGTTGGATTTAAATGTAACTTCGATTTC
AATTTCATAGAGGATGTTTGCAAAAAGATTGACTTTCGCCTTGATGAATATCTTTTTAAC
CCAACCAACGATGAATCTTGA


>Contig20743.0.g34(protein)
MQDQLSYNMHHEWIEKDQDILLLQNLIKSRSNIFVYGAHGSGKTTFVKDCLDSLEQSSSS
LSAQSQQHIYHIYIDCIEYYSEKLIATMISFQLNQILQKFAISNQLTKTQARKYQVRSCR
NFPMLMDAMQGFCSYYDNEKNSSDSILKSEFFFYIVLDNIQNLLEIERTKKLLTKLCVIQ
SLLTPQCFSLLVINHCLVQEIEVLKDQQGIFEEYMFTCFFFLPMVENQIHSILLEKLRVK
FGTQPYLEIAFEKMFNQLFSDIKSYTRNINEYEYYFTFLYPSYIEPLKNLTDKEIDARLQ
KPLSNKNFLGQEREVKSALFMHYQSMDDVKKNLEMQIDQEFQEKIKEQNKAQRFQNQEIL
KQKTFEVLVINQLENSKKNMNFTYMQSLCLIAAYLAGANKECIDQRMFQNRSISTRSKKG
LTNVKSDQQKQPGQGQFMLGKTKKFYFERYAGIIDYLVSLVAEESKENYCIGRSLDYIAC
INSMCEEGLIKKSTMKKGASGGGDGGDELVNVGFKCNFDFNFIEDVCKKIDFRLDEYLFN
PTNDES