Identifiers and Description

Gene Model Identifier

Contig17687.0.0.g37

Standard Name

DDXH16

Aliases

Contig17687_0_0_g37

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00071 ) Ras family
  • ( pfam08477 ) Miro-like protein
  • ( pfam00025 ) ADP-ribosylation factor family
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam04670 ) Gtr1/RagA G protein conserved region
  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam13191 ) AAA ATPase domain
  • ( pfam03193 ) Protein of unknown function, DUF258
  • ( pfam03205 ) Molybdopterin guanine dinucleotide synthesis protein B
  • ( pfam02750 ) Synapsin, ATP binding domain
  • ( pfam00004 ) ATPase family associated with various cellular activities (AAA)
  • ( pfam00910 ) RNA helicase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004708102.0009605191578312e-25Ras family protein
SGDYML001W5.00094715178354e-25YPT7 SGDID:S000004460, Chr XII
I from 267174-267800, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17687.0.0.g37(coding)
ATGAATGACAGCAATTCTAATCAAGCAAGTTTTGTAAATATGAGAGGGGGTTCAGGACAA
AACGACTTTGACAAGAGCTTTGCAAATTAAATGATGTGCAGTGGGAAGCAAATTGTTTTG
AAAGTTATACTTCTTGGAGATTCCAGCGTGGGAAAGACCAGCATAATTAATTAATATGTC
AAGAAAATTTTCTCTGATAATTTAAAACCAACTATTGGAGTGGATTTTGCAAATTAGGTA
ATAAAAAAAGACGATTTAAAAAGCAGGTCTACATCTTGCGATGGAGGGACCCGGTATGCT
TAAGGTCAATACTTAGAAGAATCAATAATGCTGCAAATTTGGGACACCATGGGTCAAGAA
ATGTTTAAAAGTATAAATCGTATGTATTACCGAGGTGTTCACGGAGTTGTCCTTGTTTGT
GATCTTTATTAAACTGTGTCACTTAATCACTTAAATTAATGGCTTCAAGAGTTTTTGCAA
AAATAAGACCGATCTGCCAACTATAGCGACTTTGCATTTGTCTTACTGGCAAATAAATGT
GATAAAACTGAGCCTCCCTTGATCTCGGAAGAGGAAATAATTTCATGGTGTGAGAAACAA
AGAGAAGCATGCTATCGTAAGCGCCAAAACTGGAGAAGGAATTAATGA


>Contig17687.0.0.g37(protein)
MNDSNSNQASFVNMRGGSGQNDFDKSFANQMMCSGKQIVLKVILLGDSSVGKTSIINQYV
KKIFSDNLKPTIGVDFANQVIKKDDLKSRSTSCDGGTRYAQGQYLEESIMLQIWDTMGQE
MFKSINRMYYRGVHGVVLVCDLYQTVSLNHLNQWLQEFLQKQDRSANYSDFAFVLLANKC
DKTEPPLISEEEIISWCEKQREACYRKRQNWRRNQ