Identifiers and Description

Gene Model Identifier

Contig93.1.g72

Standard Name

DDXH15

Aliases

Contig93_1_g72

Description

AAA domain

Genome Browser

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

• viral capsid (IEA) | GO:0019028
• integral component of mitochondrial inner membrane (IEA) | GO:0031305
• bacterial-type flagellum (IEA) | GO:0009288
• proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177
• cytoplasm (IEA) | GO:0005737
• viral envelope (IEA) | GO:0019031
• microtubule (IEA) | GO:0005874
• microtubule-based flagellum (IEA) | GO:0009434
• nuclear pore (IEA) | GO:0005643
• fibrinogen complex (IEA) | GO:0005577
• nucleus (IEA) | GO:0005634
• integral component of membrane (IEA) | GO:0016021

Molecular Function

• proton transmembrane transporter activity (IEA) | GO:0015078
• structural molecule activity (IEA) | GO:0005198
• protein binding, bridging (IEA) | GO:0030674
• serine-tRNA ligase activity (IEA) | GO:0004828
• DNA binding (IEA) | GO:0003677
• ATP binding (IEA) | GO:0005524
• glycogen (starch) synthase activity (IEA) | GO:0004373
• catalytic activity (IEA) | GO:0003824
• adenyl-nucleotide exchange factor activity (IEA) | GO:0000774
• structural constituent of nuclear pore (IEA) | GO:0017056
• protein homodimerization activity (IEA) | GO:0042803
• signaling receptor binding (IEA) | GO:0005102
• chaperone binding (IEA) | GO:0051087
• nucleotide binding (IEA) | GO:0000166

Biological Process

• division septum assembly (IEA) | GO:0000917
• positive regulation of autophagy (IEA) | GO:0010508
• protein folding (IEA) | GO:0006457
• cell adhesion (IEA) | GO:0007155
• ATP hydrolysis coupled proton transport (IEA) | GO:0015991
• FtsZ-dependent cytokinesis (IEA) | GO:0043093
• signal transduction (IEA) | GO:0007165
• platelet activation (IEA) | GO:0030168
• microtubule cytoskeleton organization (IEA) | GO:0000226
• seryl-tRNA aminoacylation (IEA) | GO:0006434
• cell motility (IEA) | GO:0048870
• regulation of transcription, DNA-templated (IEA) | GO:0006355
• glycogen biosynthetic process (IEA) | GO:0005978
• protein polymerization (IEA) | GO:0051258
• transport (IEA) | GO:0006810
• mRNA splicing, via spliceosome (IEA) | GO:0000398
• cell cycle (IEA) | GO:0007049
• protein import into nucleus (IEA) | GO:0006606

Domains

• ( pfam13166 ) AAA domain
• ( pfam08317 ) Spc7 kinetochore protein
• ( pfam05693 ) Glycogen synthase
• ( pfam09731 ) Mitochondrial inner membrane protein
• ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
• ( pfam11559 ) Afadin- and alpha -actinin-Binding
• ( pfam10186 ) UV radiation resistance protein and autophagy-related subunit 14
• ( pfam08124 ) Polysaccharide lyase family 8, N terminal alpha-helical domain
• ( pfam04582 ) Reovirus sigma C capsid protein
• ( pfam09789 ) Uncharacterized coiled-coil protein (DUF2353)
• ( pfam07888 ) Calcium binding and coiled-coil domain (CALCOCO1) like
• ( pfam04977 ) Septum formation initiator
• ( pfam07889 ) Protein of unknown function (DUF1664)
• ( pfam04102 ) SlyX
• ( pfam03148 ) Tektin family
• ( pfam09726 ) Transmembrane protein
• ( pfam11180 ) Protein of unknown function (DUF2968)
• ( pfam13086 ) AAA domain
• ( pfam12325 ) TATA element modulatory factor 1 TATA binding
• ( pfam07195 ) Flagellar hook-associated protein 2 C-terminus
• ( pfam07926 ) TPR/MLP1/MLP2-like protein
• ( pfam13851 ) Growth-arrest specific micro-tubule binding
• ( pfam11656 ) YjbD family (DUF3811)
• ( pfam13012 ) Maintenance of mitochondrial structure and function
• ( pfam08614 ) Autophagy protein 16 (ATG16)
• ( pfam01496 ) V-type ATPase 116kDa subunit family
• ( pfam09665 ) Type II restriction endonuclease (RE Alw26IDE)
• ( pfam08702 ) Fibrinogen alpha/beta chain family
• ( pfam13476 ) AAA domain
• ( pfam08961 ) Domain of unknown function (DUF1875)
• ( pfam06424 ) PRP1 splicing factor, N-terminal
• ( pfam05103 ) DivIVA protein
• ( pfam10234 ) Clusterin-associated protein-1
• ( pfam04156 ) IncA protein
• ( pfam06148 ) COG (conserved oligomeric Golgi) complex component, COG2
• ( pfam08700 ) Vps51/Vps67
• ( pfam05377 ) Flagella accessory protein C (FlaC)
• ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
• ( pfam02183 ) Homeobox associated leucine zipper
• ( pfam06156 ) Protein of unknown function (DUF972)
• ( pfam04883 ) Bacteriophage protein of unknown function (DUF646)
• ( pfam08581 ) Tup N-terminal
• ( pfam13874 ) Nucleoporin complex subunit 54
• ( pfam05531 ) Nucleopolyhedrovirus P10 protein
• ( pfam05064 ) Nsp1-like C-terminal region
• ( pfam06005 ) Protein of unknown function (DUF904)
• ( pfam11827 ) Protein of unknown function (DUF3347)
• ( pfam09674 ) Protein of unknown function (DUF2400)
• ( pfam03131 ) bZIP Maf transcription factor
• ( pfam04513 ) Baculovirus polyhedron envelope protein, PEP, C terminus
• ( pfam07072 ) Protein of unknown function (DUF1342)
• ( pfam01105 ) emp24/gp25L/p24 family/GOLD
• ( pfam06103 ) Bacterial protein of unknown function (DUF948)
• ( pfam10211 ) Axonemal dynein light chain
• ( pfam01367 ) 5'-3' exonuclease, C-terminal SAM fold
• ( pfam11819 ) Domain of unknown function (DUF3338)
• ( pfam13600 ) N-terminal domain of unknown function (DUF4140)
• ( pfam14362 ) Domain of unknown function (DUF4407)
• ( pfam10046 ) Biogenesis of lysosome-related organelles complex-1 subunit 2
• ( pfam01025 ) GrpE

Gene Expression Profile

Homologs

Source	Identifier	Score	Description
T. thermophila	TTHERM_00205170	6.998168281769004e-37	hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig93.1.g72(coding)
ATGATGCAGACAAATAAAATGAATTAATCGCTCAATTCTCAATATGGGTACTCCTCTGTT
GGTGGAGCAGATAAATCAAACAGTTTAAAGGGAACTCTAGTCCGATTGGAGGAAATGGTA
ACAGCAATAAATGATGAAGTTTCTTATCACAAGAAGGAGGTGCAGCATCTCAGAGCGGAA
AAAGAGTCGTTGGAAAATGTGCTCGCACTCAAGGCCTAAGAAGTCAGAAAGACCTTGACA
AATGAAGCAAATAGAATCGAAGAGGAGTTAAAGAGAAATCTCGCTCAACAAAGAGCTGAA
AACACCAAGTTATCGTAATAAATATCAGCTATAAAAACTGAAAAGACTTAATTACAAAAG
AATTTGTTGGCTCTATAAAAGAGAATTCAAGAACTTGAATTGCAAATTGGTGGAGAGGAT
GCACCAAAGTAATGA

>Contig93.1.g72(protein)
MMQTNKMNQSLNSQYGYSSVGGADKSNSLKGTLVRLEEMVTAINDEVSYHKKEVQHLRAE
KESLENVLALKAQEVRKTLTNEANRIEEELKRNLAQQRAENTKLSQQISAIKTEKTQLQK
NLLALQKRIQELELQIGGEDAPKQ