Identifiers and Description
Gene Model Identifier
Contig93.1.g72Standard Name
DDXH15Aliases
Contig93_1_g72Description
AAA domainGenome Browser
![]()
Genome Browser (Micronucleus)
Micronuclear Genome Browser
Gene Ontology Annotations
Cellular Component
- viral envelope (IEA) | GO:0019031
- microtubule (IEA) | GO:0005874
- microtubule-based flagellum (IEA) | GO:0009434
- nuclear pore (IEA) | GO:0005643
- fibrinogen complex (IEA) | GO:0005577
- nucleus (IEA) | GO:0005634
- integral component of membrane (IEA) | GO:0016021
- viral capsid (IEA) | GO:0019028
- integral component of mitochondrial inner membrane (IEA) | GO:0031305
- bacterial-type flagellum (IEA) | GO:0009288
- proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177
- cytoplasm (IEA) | GO:0005737
Molecular Function
- glycogen (starch) synthase activity (IEA) | GO:0004373
- catalytic activity (IEA) | GO:0003824
- structural constituent of nuclear pore (IEA) | GO:0017056
- adenyl-nucleotide exchange factor activity (IEA) | GO:0000774
- protein homodimerization activity (IEA) | GO:0042803
- signaling receptor binding (IEA) | GO:0005102
- nucleotide binding (IEA) | GO:0000166
- chaperone binding (IEA) | GO:0051087
- proton transmembrane transporter activity (IEA) | GO:0015078
- protein binding, bridging (IEA) | GO:0030674
- structural molecule activity (IEA) | GO:0005198
- serine-tRNA ligase activity (IEA) | GO:0004828
- ATP binding (IEA) | GO:0005524
- DNA binding (IEA) | GO:0003677
Biological Process
- platelet activation (IEA) | GO:0030168
- seryl-tRNA aminoacylation (IEA) | GO:0006434
- microtubule cytoskeleton organization (IEA) | GO:0000226
- cell motility (IEA) | GO:0048870
- protein polymerization (IEA) | GO:0051258
- regulation of transcription, DNA-templated (IEA) | GO:0006355
- glycogen biosynthetic process (IEA) | GO:0005978
- mRNA splicing, via spliceosome (IEA) | GO:0000398
- transport (IEA) | GO:0006810
- cell cycle (IEA) | GO:0007049
- protein import into nucleus (IEA) | GO:0006606
- division septum assembly (IEA) | GO:0000917
- positive regulation of autophagy (IEA) | GO:0010508
- cell adhesion (IEA) | GO:0007155
- protein folding (IEA) | GO:0006457
- ATP hydrolysis coupled proton transport (IEA) | GO:0015991
- FtsZ-dependent cytokinesis (IEA) | GO:0043093
- signal transduction (IEA) | GO:0007165
Domains
- ( pfam13166 ) AAA domain
- ( pfam08317 ) Spc7 kinetochore protein
- ( pfam05693 ) Glycogen synthase
- ( pfam09731 ) Mitochondrial inner membrane protein
- ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
- ( pfam11559 ) Afadin- and alpha -actinin-Binding
- ( pfam10186 ) UV radiation resistance protein and autophagy-related subunit 14
- ( pfam08124 ) Polysaccharide lyase family 8, N terminal alpha-helical domain
- ( pfam04582 ) Reovirus sigma C capsid protein
- ( pfam09789 ) Uncharacterized coiled-coil protein (DUF2353)
- ( pfam07888 ) Calcium binding and coiled-coil domain (CALCOCO1) like
- ( pfam04977 ) Septum formation initiator
- ( pfam07889 ) Protein of unknown function (DUF1664)
- ( pfam04102 ) SlyX
- ( pfam03148 ) Tektin family
- ( pfam09726 ) Transmembrane protein
- ( pfam11180 ) Protein of unknown function (DUF2968)
- ( pfam13086 ) AAA domain
- ( pfam12325 ) TATA element modulatory factor 1 TATA binding
- ( pfam07195 ) Flagellar hook-associated protein 2 C-terminus
- ( pfam07926 ) TPR/MLP1/MLP2-like protein
- ( pfam13851 ) Growth-arrest specific micro-tubule binding
- ( pfam11656 ) YjbD family (DUF3811)
- ( pfam13012 ) Maintenance of mitochondrial structure and function
- ( pfam08614 ) Autophagy protein 16 (ATG16)
- ( pfam01496 ) V-type ATPase 116kDa subunit family
- ( pfam09665 ) Type II restriction endonuclease (RE Alw26IDE)
- ( pfam08702 ) Fibrinogen alpha/beta chain family
- ( pfam13476 ) AAA domain
- ( pfam08961 ) Domain of unknown function (DUF1875)
- ( pfam06424 ) PRP1 splicing factor, N-terminal
- ( pfam05103 ) DivIVA protein
- ( pfam10234 ) Clusterin-associated protein-1
- ( pfam04156 ) IncA protein
- ( pfam06148 ) COG (conserved oligomeric Golgi) complex component, COG2
- ( pfam08700 ) Vps51/Vps67
- ( pfam05377 ) Flagella accessory protein C (FlaC)
- ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
- ( pfam02183 ) Homeobox associated leucine zipper
- ( pfam06156 ) Protein of unknown function (DUF972)
- ( pfam04883 ) Bacteriophage protein of unknown function (DUF646)
- ( pfam08581 ) Tup N-terminal
- ( pfam13874 ) Nucleoporin complex subunit 54
- ( pfam05531 ) Nucleopolyhedrovirus P10 protein
- ( pfam05064 ) Nsp1-like C-terminal region
- ( pfam06005 ) Protein of unknown function (DUF904)
- ( pfam11827 ) Protein of unknown function (DUF3347)
- ( pfam09674 ) Protein of unknown function (DUF2400)
- ( pfam03131 ) bZIP Maf transcription factor
- ( pfam04513 ) Baculovirus polyhedron envelope protein, PEP, C terminus
- ( pfam07072 ) Protein of unknown function (DUF1342)
- ( pfam01105 ) emp24/gp25L/p24 family/GOLD
- ( pfam06103 ) Bacterial protein of unknown function (DUF948)
- ( pfam10211 ) Axonemal dynein light chain
- ( pfam01367 ) 5'-3' exonuclease, C-terminal SAM fold
- ( pfam11819 ) Domain of unknown function (DUF3338)
- ( pfam13600 ) N-terminal domain of unknown function (DUF4140)
- ( pfam14362 ) Domain of unknown function (DUF4407)
- ( pfam10046 ) Biogenesis of lysosome-related organelles complex-1 subunit 2
- ( pfam01025 ) GrpE
Gene Expression Profile
No expression data available at this time.
Homologs
Source Identifier Score Description T. thermophila TTHERM_00205170 6.998168281769004e-37 hypothetical protein
General Information
No Data fetched for General Information
Associated Literature
No Data fetched for Associated Literature
Sequences
>Contig93.1.g72(coding)
ATGATGCAGACAAATAAAATGAATTAATCGCTCAATTCTCAATATGGGTACTCCTCTGTT
GGTGGAGCAGATAAATCAAACAGTTTAAAGGGAACTCTAGTCCGATTGGAGGAAATGGTA
ACAGCAATAAATGATGAAGTTTCTTATCACAAGAAGGAGGTGCAGCATCTCAGAGCGGAA
AAAGAGTCGTTGGAAAATGTGCTCGCACTCAAGGCCTAAGAAGTCAGAAAGACCTTGACA
AATGAAGCAAATAGAATCGAAGAGGAGTTAAAGAGAAATCTCGCTCAACAAAGAGCTGAA
AACACCAAGTTATCGTAATAAATATCAGCTATAAAAACTGAAAAGACTTAATTACAAAAG
AATTTGTTGGCTCTATAAAAGAGAATTCAAGAACTTGAATTGCAAATTGGTGGAGAGGAT
GCACCAAAGTAATGA>Contig93.1.g72(protein)
MMQTNKMNQSLNSQYGYSSVGGADKSNSLKGTLVRLEEMVTAINDEVSYHKKEVQHLRAE
KESLENVLALKAQEVRKTLTNEANRIEEELKRNLAQQRAENTKLSQQISAIKTEKTQLQK
NLLALQKRIQELELQIGGEDAPKQ