Identifiers and Description

Gene Model Identifier

Contig93.1.g72

Standard Name

DDXH15

Aliases

Contig93_1_g72

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13166 ) AAA domain
  • ( pfam08317 ) Spc7 kinetochore protein
  • ( pfam05693 ) Glycogen synthase
  • ( pfam09731 ) Mitochondrial inner membrane protein
  • ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
  • ( pfam11559 ) Afadin- and alpha -actinin-Binding
  • ( pfam10186 ) UV radiation resistance protein and autophagy-related subunit 14
  • ( pfam08124 ) Polysaccharide lyase family 8, N terminal alpha-helical domain
  • ( pfam04582 ) Reovirus sigma C capsid protein
  • ( pfam09789 ) Uncharacterized coiled-coil protein (DUF2353)
  • ( pfam07888 ) Calcium binding and coiled-coil domain (CALCOCO1) like
  • ( pfam04977 ) Septum formation initiator
  • ( pfam07889 ) Protein of unknown function (DUF1664)
  • ( pfam04102 ) SlyX
  • ( pfam03148 ) Tektin family
  • ( pfam09726 ) Transmembrane protein
  • ( pfam11180 ) Protein of unknown function (DUF2968)
  • ( pfam13086 ) AAA domain
  • ( pfam12325 ) TATA element modulatory factor 1 TATA binding
  • ( pfam07195 ) Flagellar hook-associated protein 2 C-terminus
  • ( pfam07926 ) TPR/MLP1/MLP2-like protein
  • ( pfam13851 ) Growth-arrest specific micro-tubule binding
  • ( pfam11656 ) YjbD family (DUF3811)
  • ( pfam13012 ) Maintenance of mitochondrial structure and function
  • ( pfam08614 ) Autophagy protein 16 (ATG16)
  • ( pfam01496 ) V-type ATPase 116kDa subunit family
  • ( pfam09665 ) Type II restriction endonuclease (RE Alw26IDE)
  • ( pfam08702 ) Fibrinogen alpha/beta chain family
  • ( pfam13476 ) AAA domain
  • ( pfam08961 ) Domain of unknown function (DUF1875)
  • ( pfam06424 ) PRP1 splicing factor, N-terminal
  • ( pfam05103 ) DivIVA protein
  • ( pfam10234 ) Clusterin-associated protein-1
  • ( pfam04156 ) IncA protein
  • ( pfam06148 ) COG (conserved oligomeric Golgi) complex component, COG2
  • ( pfam08700 ) Vps51/Vps67
  • ( pfam05377 ) Flagella accessory protein C (FlaC)
  • ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
  • ( pfam02183 ) Homeobox associated leucine zipper
  • ( pfam06156 ) Protein of unknown function (DUF972)
  • ( pfam04883 ) Bacteriophage protein of unknown function (DUF646)
  • ( pfam08581 ) Tup N-terminal
  • ( pfam13874 ) Nucleoporin complex subunit 54
  • ( pfam05531 ) Nucleopolyhedrovirus P10 protein
  • ( pfam05064 ) Nsp1-like C-terminal region
  • ( pfam06005 ) Protein of unknown function (DUF904)
  • ( pfam11827 ) Protein of unknown function (DUF3347)
  • ( pfam09674 ) Protein of unknown function (DUF2400)
  • ( pfam03131 ) bZIP Maf transcription factor
  • ( pfam04513 ) Baculovirus polyhedron envelope protein, PEP, C terminus
  • ( pfam07072 ) Protein of unknown function (DUF1342)
  • ( pfam01105 ) emp24/gp25L/p24 family/GOLD
  • ( pfam06103 ) Bacterial protein of unknown function (DUF948)
  • ( pfam10211 ) Axonemal dynein light chain
  • ( pfam01367 ) 5'-3' exonuclease, C-terminal SAM fold
  • ( pfam11819 ) Domain of unknown function (DUF3338)
  • ( pfam13600 ) N-terminal domain of unknown function (DUF4140)
  • ( pfam14362 ) Domain of unknown function (DUF4407)
  • ( pfam10046 ) Biogenesis of lysosome-related organelles complex-1 subunit 2
  • ( pfam01025 ) GrpE

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002051706.998168281769004e-37hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig93.1.g72(coding)
ATGATGCAGACAAATAAAATGAATTAATCGCTCAATTCTCAATATGGGTACTCCTCTGTT
GGTGGAGCAGATAAATCAAACAGTTTAAAGGGAACTCTAGTCCGATTGGAGGAAATGGTA
ACAGCAATAAATGATGAAGTTTCTTATCACAAGAAGGAGGTGCAGCATCTCAGAGCGGAA
AAAGAGTCGTTGGAAAATGTGCTCGCACTCAAGGCCTAAGAAGTCAGAAAGACCTTGACA
AATGAAGCAAATAGAATCGAAGAGGAGTTAAAGAGAAATCTCGCTCAACAAAGAGCTGAA
AACACCAAGTTATCGTAATAAATATCAGCTATAAAAACTGAAAAGACTTAATTACAAAAG
AATTTGTTGGCTCTATAAAAGAGAATTCAAGAACTTGAATTGCAAATTGGTGGAGAGGAT
GCACCAAAGTAATGA


>Contig93.1.g72(protein)
MMQTNKMNQSLNSQYGYSSVGGADKSNSLKGTLVRLEEMVTAINDEVSYHKKEVQHLRAE
KESLENVLALKAQEVRKTLTNEANRIEEELKRNLAQQRAENTKLSQQISAIKTEKTQLQK
NLLALQKRIQELELQIGGEDAPKQ