Identifiers and Description

Gene Model Identifier

Contig9417.0.g16

Standard Name

DDXH13

Aliases

Contig9417_0_g16

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000113400.00000000030007160092483236conserved hypothetical protein
SGDYHR164C0.00003998524687536623DNA2 SGDID:S000001207, Chr VII
I from 429178-424610, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9417.0.g16(coding)
ATGTAGCAAAAGGAATCACCAATCTATTAGAGCAACTCATCGCTCTACATTCCTGAAACA
TTATCATTGCTCACTTAGCAAATCAACGAGGACTAATCCCAAGATCCAATAACTCAATTG
AAAAGTATTAATGGAAATTTGCCTTACTAAACAAACTTCTCTCCAACTTAAGCAAACTTA
ATGAAAGATTGCTCACCTAAATAGTAGAAATATGACGCAAACTCACATAAGCCATCATCT
TAGAATCCCTAAGGTTAAGTTTTAATGAATCTAAGTAAATACGATGACTGTAACAACTCA
GCTACTAGGCATGACTCGAACTTCTCTTTGCCAGATAGAGATTCAACACAAATTATTGGT
AGTGACCTGGAAGAGAGCAAATTAGATAACTAAACTGATCAGAAAATGCTTTTGGCTGGT
GAATGTCCTCAATACACCTAAGTAGATACAGGATTAGATATGGGGAAAGACTAGCAAGTG
TTGGACCCAGAGTTAATGCCAAAACTTGTAAGATATACACCTCCAATCGATTGTGGAACA
CAGATTTCTGAGAGAGCTCAATAGCTTATATCATCAATACTTACATTAGAGTTGTTCAAG
ACATATTCAGATCCTATGAGAGTTCGAGGTTTGAGAGCAATAACTAACTCAATAGATGGA
GATTTGAAATTATACAAGAAATCTTGGAATTCTCTTATTGAGTATGAAGTATACTCAAAG
CTAACTAGTGCTCAAGTCCTCAATAGTATTTAGTCAACAGATTCAAGACATGCCTAAGTA
ATGGACTTTAAACTCAGCTTCATTTTTGACAAGAATAATGGCATCCTATTACCAGTCAAA
GACAAATCTTTCCTTTCTTCAGAGTAATTAATGCAAGAACGATAGTGCCAAACTGACACA
TTCTTTTCTGATGTCAAAGCATTCGATGTTGTCATAATAAGCTAGAATCCTTTATAAATC
AGTCAAAAAAGTGAGATCCTGCCTCAGTTAGTTGAGTATGTCAAATAAAACATTCATAAT
CAGGGCAAGCTAGTGTTAGGTGTGTGTCAATCACAATTCAACCAGGGGAATGATAACTCA
ACTATTGATTACTTGCCTTGCAAAGTCTCGATAAAACTATCAGAAAATCATTTCTCGATG
ATGTAAACTCTCGCGGCAAGAAGCGAAGACCAATCTGGTACTATACATTTGCATGTGTAT
TTCTTGAGGAGCATAGCCAAGGACTGTGCTTAACTCATCGCACTTGATGGAATCTCAGAG
GAAAGCAGTGAGAAAGGTAGTAGAATATTCAGATATATGCTCACACCAAGGAGAGGTAAA
GCGAGAGTCATACTGGATGCTTTTGATAAAGTACAGGGATAGATGGAGTAGAATGTTCAG
CAAGCTTAAAGTGAGAGATGTATCACATTCAACTAAAATGAATTGCTGACTAAGTTTATC
TAATTTTAGAAAGAAAATCTGATAATTATAAATGGAATGTCTGGAAGTGGTAAAACTGTG
TCTGCCCTAACAATTGCTATTTTGAAGCTATACTCTGGCACAAGAAAAGTTCTGTATCTA
GTTCCAAACTATGAGAGTTTATTCTGTATAACTAGAATGATTAACTCTAGTATGTTATTT
AAAGGGCATGTACTGAAGTAAAATTTACTGATATTGGATGGAGAAAGCTCACCAAGTAGA
TATGAAGAGTTATCTGATTCTTGCCTCTCTAAACTCTTCAGCAATACTTTCAATTTTCAC
TTGAAAATGTAATCCACCAGTAGTGAGCCATATGAAATAAACTCCCTGAATATACTTCAA
TAGGTGTTCTAAAACTCCCAGTTTATCTTGGGAACCTTCGAATTCTTACATCACTAAAAT
CTAAACTATTTAATACCATAAATTTAGACAATCATCATCGACGATGCACATTCTATGTCA
GAGCCAGATTTGCTTCTGACTTTCCAAATGAATCCCTATTAACTGATTCTAGTTGGATGT
GAGGAACTGCCCAGGACTTAAGTTTACTCTCATAATGCTATGACCACTTAGTTCAGCAAG
AGCACCTTGGAAAGAATGATAGAGCAAGATTTCAACTATTTCAAGATGCGTGGCTAGCTC
AGAGTCGGTCATATCCAATGCCAAATAATTAACAGGATGCTGTATAAAAATAACACAATT
TAGATGAATGCTCCTAGGTAATAATAAACAGCTTTCAATGATGATTTGACTTGCTTGAGA
AACTTTATGAGAAGAGTCCTACTATTTGATTTGACTTACTTGCTTGAGTTGAAACAATCC
TCCTTCAAATCAGACTTTGACGAAATCAATTTTACAATCTCCCTCATTGGCGATCTCACT
AGACTAGTATCTGAGATTGAAGGAATCAGAGCTACCAGAGATGATGACAGGATGCAACAT
TCATTTAGCAAACTTCGTGGACATATTGGAATAGTTGTACCGCATGAGCGCTGTATCGAT
TCTTTCAAGCTATTCTTTAAGAATCTGGAGAAGAAGCTGGGCATATCTTCTGAAGAGGGT
GATTGCAACAATGGGGATGTATACGTTGGAACTCCCTAGATGTTCAGAGGGGTGGAGAAG
CACATCATAATAGTTTGTGGACTAAGAAACTCATAGGTAGATGGACTTGGCTAACTTGAG
GATGCTCAAAACATTAAGTTAATCATGACTAGAGCAAAATCCTTTTTGTGGGTAGTTGGT
AGCTCACCATGGTTCATGCACAATCAATACTGGAAAGATTTCCTCATGGCATCCAAATTA
ATATCAGTTGGGCAGTACAACAACTACATACCATTTGAGAATTTCAAGGACTGGAGCTAC
CCTAAAATGAGAGACATGCTCAGATCCTTTGTTAGAAGAGGTGGAGACAGATCACCAACA
AATAGAAGTCCTAAGAATAATCGTAGTGATAGAAATGACAATGCTGATGGACCACAAAAC
AGATCTAGATCTCCACGAGGCAACTACAGAGGAGGCAGAAGAGAAGGGAGTAGATCTCCT
AAGAACAACAATCACTCAAGATTTGACAACTCACAGAACAATCACCACAGAAACTAGTAC
AGCCACTAGCAGCAGTAGCAGAAGGGCATGAGCTACCAAGAAAGACTTCAGCAAATGCTA
ACAGTTGGCTCTGGAAACAACCAGCGTAGACACTTGTAGTAAATGGAAAGGGAAAAAGAG
AGAGAACACAAAGAAAGATAGGACATGTGGAACAAGAGAAAGCCCACTGAGAGAGACTGG
GATGCAGTGGACAGTGGAAACTTGAGCTTCAACACTTTGCAGCAGTAGAAAGACAACTCT
CCAAAGAGACGGTACGAGAGATACCCCCCATAGACCAGTGTCAAGTCAGAAGAGGATGGG
TGGAGTACTTCTTCAAGCAGATAAATCGATAACTATGCCATTGATAAGAAAGAACAGCAA
CAGTCCAATGATTACTGGTGA


>Contig9417.0.g16(protein)
MQQKESPIYQSNSSLYIPETLSLLTQQINEDQSQDPITQLKSINGNLPYQTNFSPTQANL
MKDCSPKQQKYDANSHKPSSQNPQGQVLMNLSKYDDCNNSATRHDSNFSLPDRDSTQIIG
SDLEESKLDNQTDQKMLLAGECPQYTQVDTGLDMGKDQQVLDPELMPKLVRYTPPIDCGT
QISERAQQLISSILTLELFKTYSDPMRVRGLRAITNSIDGDLKLYKKSWNSLIEYEVYSK
LTSAQVLNSIQSTDSRHAQVMDFKLSFIFDKNNGILLPVKDKSFLSSEQLMQERQCQTDT
FFSDVKAFDVVIISQNPLQISQKSEILPQLVEYVKQNIHNQGKLVLGVCQSQFNQGNDNS
TIDYLPCKVSIKLSENHFSMMQTLAARSEDQSGTIHLHVYFLRSIAKDCAQLIALDGISE
ESSEKGSRIFRYMLTPRRGKARVILDAFDKVQGQMEQNVQQAQSERCITFNQNELLTKFI
QFQKENLIIINGMSGSGKTVSALTIAILKLYSGTRKVLYLVPNYESLFCITRMINSSMLF
KGHVLKQNLLILDGESSPSRYEELSDSCLSKLFSNTFNFHLKMQSTSSEPYEINSLNILQ
QVFQNSQFILGTFEFLHHQNLNYLIPQIQTIIIDDAHSMSEPDLLLTFQMNPYQLILVGC
EELPRTQVYSHNAMTTQFSKSTLERMIEQDFNYFKMRGQLRVGHIQCQIINRMLYKNNTI
QMNAPRQQQTAFNDDLTCLRNFMRRVLLFDLTYLLELKQSSFKSDFDEINFTISLIGDLT
RLVSEIEGIRATRDDDRMQHSFSKLRGHIGIVVPHERCIDSFKLFFKNLEKKLGISSEEG
DCNNGDVYVGTPQMFRGVEKHIIIVCGLRNSQVDGLGQLEDAQNIKLIMTRAKSFLWVVG
SSPWFMHNQYWKDFLMASKLISVGQYNNYIPFENFKDWSYPKMRDMLRSFVRRGGDRSPT
NRSPKNNRSDRNDNADGPQNRSRSPRGNYRGGRREGSRSPKNNNHSRFDNSQNNHHRNQY
SHQQQQQKGMSYQERLQQMLTVGSGNNQRRHLQQMEREKEREHKERQDMWNKRKPTERDW
DAVDSGNLSFNTLQQQKDNSPKRRYERYPPQTSVKSEEDGWSTSSSRQIDNYAIDKKEQQ
QSNDYW