Identifiers and Description

Gene Model Identifier

Contig6679.0.g52

Standard Name

DDXH12

Aliases

Contig6679_0_g52

Description

Man1-Src1p-C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam09402 ) Man1-Src1p-C-terminal domain
  • ( pfam02009 ) Rifin/stevor family
  • ( pfam09911 ) Uncharacterized protein conserved in bacteria (DUF2140)
  • ( pfam13584 ) Oxygen tolerance
  • ( pfam13727 ) CoA-binding domain
  • ( pfam06143 ) Baculovirus 11 kDa family
  • ( pfam13908 ) Wnt and FGF inhibitory regulator
  • ( pfam03918 ) Cytochrome C biogenesis protein
  • ( pfam00001 ) 7 transmembrane receptor (rhodopsin family)
  • ( pfam02699 ) Preprotein translocase subunit
  • ( pfam14316 ) Domain of unknown function (DUF4381)
  • ( pfam13882 ) C-terminal domain of Fibronectin type III
  • ( pfam02932 ) Neurotransmitter-gated ion-channel transmembrane region
  • ( pfam02480 ) Alphaherpesvirus glycoprotein E
  • ( pfam13965 ) dsRNA-gated channel SID-1
  • ( pfam13654 ) AAA domain
  • ( pfam11669 ) WW domain-binding protein 1
  • ( pfam06024 ) Nucleopolyhedrovirus protein of unknown function (DUF912)
  • ( pfam03356 ) Viral late protein H2
  • ( pfam05569 ) BlaR1 peptidase M56
  • ( pfam12669 ) Virus attachment protein p12 family
  • ( pfam13800 ) Sigma factor regulator N-terminal
  • ( pfam12698 ) ABC-2 family transporter protein
  • ( pfam12273 ) Chitin synthesis regulation, resistance to Congo red

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6679.0.g52(coding)
ATGGCATTTTTGAACAAAGAATATTAATCTCTGTAACAAGATTCAGCTTAGATTGAGAAT
TCAATGTTTTCTAGCTCAGTTGATTCTCCAAGAAGCCATGTGAGATCATCTTCAGAGAAT
AATTTGATACCTACATTCTGCATTATTTCATTTTGGATCTTGATCGTTGTCATCCTCATG
ATTACTGTTCTGCTTATAATTTACTAAGTTAGAAAGAGAAGAAGAGAGCGCACTTAAATT
CGGGAATATATTAGGAAGTCTAGTTAAGATCTTGCTCAATCTATGGATTAAAGACTTGAG
ACTAGTGCCGGAGGGTATGCAACCAGAGCCAATCAATAAGATGATATGCAGTACGAGCTA
CCACTGGTTGTACTGTAAAGCAAGTTACCTCCACAAATGAGTTAATCTAATTAATATATT
TCACCCGCAGCTCGTATCTCTCAATCACCAACCTCAGCATAGCTCAATCAAAGATTGTTA
CAGTCAGAAATCAGCATTTAGGATTAACCAAATCCTTAGGAGTTTTGA


>Contig6679.0.g52(protein)
MAFLNKEYQSLQQDSAQIENSMFSSSVDSPRSHVRSSSENNLIPTFCIISFWILIVVILM
ITVLLIIYQVRKRRRERTQIREYIRKSSQDLAQSMDQRLETSAGGYATRANQQDDMQYEL
PLVVLQSKLPPQMSQSNQYISPAARISQSPTSAQLNQRLLQSEISIQDQPNPQEF