Identifiers and Description

Gene Model Identifier

Contig19154.0.g87

Standard Name

DDXH11

Aliases

Contig19154_0_g87

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004677904.000904604388404e-59Ras family protein
SGDYER031C9.996696112986116e-50YPT31 SGDID:S000000833, Chr V
from 214747-214076, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19154.0.g87(coding)
ATGGAGAGATCTGAAGACTACGAATACAATAATCTAAATCAAATAGAAGGGCTTAGACAT
GAAATTATCACAGATAAGGCTTTATCTTATCATGATGCTCTGTTTAAAATCATCATAATT
GGGGACTCAGGTATTGGAAAATCTTGCGTTTTGAAGAGATTAGTAGACAATGAATTTAAG
GAAGATCACGATGTGACAGTAGGAGTAGAATTCGGCTCTTTTTTAATAAAGATTGAGGAC
AAAGTGCTTAAATTGTAGATTTGGGACACAGCAGGACAAGAAAGTTTTAGGTCTATAACC
AAGATATTCTACAGAGGAGCCCACACTGCAATTTTAGGTTACTCAATCACTTAAAGAGAT
ACATTTGATAATTTGGAGGACTGGCTTAGAGAAGCTAAAAGTTCATGTCAACCTGATGTA
CTCATGACTTTAATAGGAAATAAATCTGATCTTGAGCAGAAAAGATAAGTGAGTCATGAC
GAGGGATTAATGTTCAAGAAGAAAAATAACTTGCTATATTTTACCGAGACATCTGCAAAA
AACGGAGATAATATTGATAAAATGTTCATAGACCTCGCTAAATTTATCTATCTAAAATAC
AAAGATCAGCTTCATAATATGATAGATGACGAGACTTCTTCATAAAACTCCAGGTCAAAT
AGTTTTGATTAAAATCAAATGAAAAATGGGATGGGCTAAGGGTAGAACTAAAAAATGAAT
CAAATGAGGTTAAGAGGCAAGTTGAGATAGTAGTAAAAGGATACAGGATGCAAGTGCTGA


>Contig19154.0.g87(protein)
MERSEDYEYNNLNQIEGLRHEIITDKALSYHDALFKIIIIGDSGIGKSCVLKRLVDNEFK
EDHDVTVGVEFGSFLIKIEDKVLKLQIWDTAGQESFRSITKIFYRGAHTAILGYSITQRD
TFDNLEDWLREAKSSCQPDVLMTLIGNKSDLEQKRQVSHDEGLMFKKKNNLLYFTETSAK
NGDNIDKMFIDLAKFIYLKYKDQLHNMIDDETSSQNSRSNSFDQNQMKNGMGQGQNQKMN
QMRLRGKLRQQQKDTGCKC