Identifiers and Description

Gene Model Identifier

Contig17322.0.g16

Standard Name

DDXH10

Aliases

Contig17322_0_g16

Description

ABC transporter

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001463502.000724368835138e-100ABC transporter family protein
SGDYOL075C1.9991095569230066e-20YOL075C SGDID:S000005435, Chr
XV from 193542-189658, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17322.0.g16(coding)
ATGGTTTAGGATAATTAGCAGGTCTTGAAAATTTCACATTGGAGACAACTTAAAGCGTTG
ACTTTTAAAGCCATATCTATACAACGAAGACTTTCGGTTGGCACAATTTCCTAGTACTTA
ATGTCTTTTCTTTCCTTTATCGGTTCAGCAGCTGTTTTTGGGGTATCATTCATCAATACT
TCCAAAAAAGATGGAAGTCTATTCACAACAGACCTCAGACTGATCTTTATTTTGGTGATG
AGTTTACCTTACATTTCACTCACTAAAAACATTTTTCAGCAAATAATTTTGGACAAGGAG
ACTAAAATGATTGAAATCTTAAAATTCAACAATTTGTCACCTATTACATATGGGCTTAGC
TTCATCACTCAACATATTACCTTTGTTATATACACGGCAATGTCAGTTATAGCCTAAATC
ATCATAATACACATTATTCAGCCAAATTCCGACACATGTGTAGAATAAAGACCTTGGCAG
TTTATTGGACTATTTTTCAATTTGATTTTATTTGCTTTTGCCTTGATATGCTTCAGTTTA
TTCGTATCCATATTTTTCCACAATTCCAAACTGGGTTAATTAATTGGTTCACAAATCTTT
CTCCTCCCAGTTATGACTTTTACCTTTTTATACAATACAAGCCTAAATGATAATGACTTA
TCTCTCAGTTAATTCTTGGTGTTTATCCCTCATTATCCATCGTTCTTGTATATTTTTGAC
CTGACTGGCTGTTTCAATTTAGTAGCAACAGGAAAAGATTAAGATGCATAAGTTGATCTA
CATTTGACATCAAAACTATCTTTCCTGTTTTTGATTTTTGATATCCTTCTCTACTTTGGC
CTATATGTGTACTTTTCAGATTTCTCAAAGAAAAGAAAACTAGTGAAGTCAGATTCCTCA
AAGAATTCTAAGGTGATTTAGGAATAAAACTAAAATAAGAGCTCTGTTGATTAAGAGAAT
CTTTTAAGTGAAGATTAAAATGTTATTACCCAAACTTACAGTTCCAAGAAAATTGCGATT
GAGATTACTAATTTGTCGATGAAATTCGATGATTTTTATGCAATTAAAAACTTAGATCTT
GTAGTCAATTAAAACGAATTAATCTGTTTAATTGGACCAAATGGGTCTGGAAAGTCAACA
TTACTTAATATGATTAGTGGGTTGCTTAAACAAACTACAGGCTCAATCAAAATCTATGGT
GAAGAATTAAATAAAGAAAATAAGAGATGGCTCTTAGATTTCTGCCTTCAAGAAGACACT
TTGATCGACAACTACACAATTGAAGAGCACCTAAAAATCATCTGTGACTTGAAAAACATT
CCAGAGGGAGAGATGAAATAGAACGTTGAGGATGTTTTGAAAACATTAAACTTATATGAA
CATAGAGACAAATTTTCACAGGACTTATCTTTAGGTACGAAGAGGAAGCTTCAAATGGGC
ATGTCTTTACTTGGGAGCAAGAGCATCTTAATATTGGATGAAATTACTTCAGGGTTGGAT
ATTGAGTCAAGAAGGTAGATTTGGGAATTGATAAAAGACTTGAAGGACAAAACTGGAAAG
ACTATAATATTCTGTACTTAGCATTTACAAGAAGCCGAAGAACTTGCAGATAAAATTTTG
TTACTAAAAGAAGGAGAAATCAAATATTTCGGAGAGCCAGATAAGTTACTTAACAACATG
CAAGATAATTATTTGGTTACTTTGAAAACAAAAACTGCAGATACTGGATTTATTGATTTC
AAGCAAGCTTAATTTGAGCTTTAATCTAACTAAGAGCTTCAAATTTAAACTACAAATTAG
AGAATACAAAACTAGGTGACTTACAAATTTAAAAAACAAGATATGGAAACAATTTTACCA
ATGCTAAACAATCTGTAAAATGAGTACTAAGGCATACAAATTGATATGTCTATTTCTAAT
TTAGAAGAAAATTACATGAAGTTCCTTTATGAGGAAGATGAGTTGCAAAAAAAGTTAACT
TAACTTTAAGATTAAATCTACTAAAGAAAATTCTATATTGGATTTGATTTCCAGTAAACT
AAAATACAAGTGTACGAACTCTTAAAAATCAGATATAAACTCTTTAAGAGAGATAAAATG
ATTCTTTTCATAAGTATTGTTACTATGGTGCTTGCATTGATAACTCTTTTTGCAAAGTTA
GCTCCAAAATCTAAATAGAGTGATGATACTTATAAATGCCTTCCAGATATAGACTTTAAG
GAAAGTTTTATTAAAGCATTTTGTTATGGACATGCAAGTATATCTGGATTACTCATTCTG
CAGATATCGTTAGATTAGGAGTCTAAATTTAGATACCTCATGAATTTAGGTGGCTTAAAA
CCCCAAATATACTGGTTGACAAACTTAGTATTTGACGTGGGGATTTATTGCTGCTTTGGA
ATATTTTTCTTATTAGTTTTATGGGCAAAATTTGGCGCATTTGTAGGAGACTATTTCCTC
TTTCCAATTTTAATTATTGGATTTGGTTTCTAATTAGTGCTTCTTATGTATATGGTAGCT
ATAAACATGAAAAACTCCAATGCAGCATTTGCTACATCTATTGCATTCACAATGGGCCTA
TCAGTTATTTTACCAATTGCTTCATAATTCTTGACAGCAAGTAACTTAATTTCTTAATCT
GGTGGCTTTTACTAACAAACTCAAATGATGAATATTGTACTTGTACTTTTAGGATTTGAT
CCTTTTGTTGGAATATAGGGCGCGATTGAAACGTAAATTGGATACTAAGAATTTAAAAGA
TCAGTCTCTCATGTTTAAGGGAATTGCAGTCTTAATAAAATGAGAGGCATCATATCTATC
TTTGACTTAGTTTGTACGCCTGTTATCACTTTAATGTTTTGTGTTTTGTTCTACAAACTC
GTTACCCACGTTGATTAAATGAAGCTGAATCAACACAGAAAGATCTATAAAAAGAAATTC
ATTCTTGATTTATTCCCCAACACATAATATATGATCTAGATAAAGAACTTGAAAAAGCAC
TATAAAAAAGACAAGCCAATTTTAGATGATTTAGATTTAGATGTGAAAAATGGTCAAATA
TTAGGACTTTTGGGACCTAATGGATGTGGTAAGAGCACACTGTTGAATATCCTAAGTTTG
GAATTAAAGAGAAATGATGGTTAGATAATCATTCTAGGGTCATACATCGATGAGTTCAGC
CCCATGATTCAAGGCTTAGATTTAGGGTACTGTTCGTAATATAACATTTTGAGATAAAAA
CTGAAAGTAGAAGAGCATCTCAATTTTATATCTGTTATCAAAGGAATGACACCTGAACAG
ATCAAGTAAAAAAAGGAGTGGCTGATGGAAGCTTTAGATCTAAAGAGATACGGAGATAAG
CGAGCAGAAACTTTGAGTGAAGGAAATAAGCGAAAACTTTGCTTAGCCATGAGTTTAATG
AGACAGCCTAAACTTTTGATTCTGGATGAGCCATTCACAGGAGTTGATCCCCTAGGCAAG
AGATAAATTTATCAAGTTCTTAAATCACTCAAAGACATCACAATAGTCCTATCTACTCAT
AGTATTGAAGAGGCAGAGGCTTTATGCGATAGAATAGTGATTATGCAGCAAGGGAAATTT
TAAGAAGATCTTACAGTGACAGAGTTGTCAAAAAGAAATGAGAGACTATACAGAATAAAG
TTGGTTCTTTAAGATTAACTAATGGCTGCACAGGTCGAAGAAGAATTAAAGACTTTAAAA
GATTTTAAATATGTTAAAGATGCTGAATATTTGAACAATGATATGCATCATGTACTGATT
TTAAGGGAATAAAATGATAATCAAAAGAACTCAGAAAATGAAACTATTATCGAAGATTAA
GCTGCTTTTGGTGTTGATGAGCCAAATCCTTATCAAAGTTAGTAGATTGATTAGACTTAA
AGTTTAGTTTCTGAATTTGAGGACAATTCAATGCAAGTACTAAAAGTATCTGATGATAGT
TAGGTTCAAATAACGAGTACTCACAACATTTTGGAAGCTATGATGAAGTTAGAAGACTTA
AAAAAAGCAAAAGAGATTATTGATTACAAAGTATATAAATCATCTTTTGAAGAAGTATTC
TCTTATGTCCAAAAGGCTAAGTCATCAGTTAGAAAAATAAATATTCAGTGA


>Contig17322.0.g16(protein)
MVQDNQQVLKISHWRQLKALTFKAISIQRRLSVGTISQYLMSFLSFIGSAAVFGVSFINT
SKKDGSLFTTDLRLIFILVMSLPYISLTKNIFQQIILDKETKMIEILKFNNLSPITYGLS
FITQHITFVIYTAMSVIAQIIIIHIIQPNSDTCVEQRPWQFIGLFFNLILFAFALICFSL
FVSIFFHNSKLGQLIGSQIFLLPVMTFTFLYNTSLNDNDLSLSQFLVFIPHYPSFLYIFD
LTGCFNLVATGKDQDAQVDLHLTSKLSFLFLIFDILLYFGLYVYFSDFSKKRKLVKSDSS
KNSKVIQEQNQNKSSVDQENLLSEDQNVITQTYSSKKIAIEITNLSMKFDDFYAIKNLDL
VVNQNELICLIGPNGSGKSTLLNMISGLLKQTTGSIKIYGEELNKENKRWLLDFCLQEDT
LIDNYTIEEHLKIICDLKNIPEGEMKQNVEDVLKTLNLYEHRDKFSQDLSLGTKRKLQMG
MSLLGSKSILILDEITSGLDIESRRQIWELIKDLKDKTGKTIIFCTQHLQEAEELADKIL
LLKEGEIKYFGEPDKLLNNMQDNYLVTLKTKTADTGFIDFKQAQFELQSNQELQIQTTNQ
RIQNQVTYKFKKQDMETILPMLNNLQNEYQGIQIDMSISNLEENYMKFLYEEDELQKKLT
QLQDQIYQRKFYIGFDFQQTKIQVYELLKIRYKLFKRDKMILFISIVTMVLALITLFAKL
APKSKQSDDTYKCLPDIDFKESFIKAFCYGHASISGLLILQISLDQESKFRYLMNLGGLK
PQIYWLTNLVFDVGIYCCFGIFFLLVLWAKFGAFVGDYFLFPILIIGFGFQLVLLMYMVA
INMKNSNAAFATSIAFTMGLSVILPIASQFLTASNLISQSGGFYQQTQMMNIVLVLLGFD
PFVGIQGAIETQIGYQEFKRSVSHVQGNCSLNKMRGIISIFDLVCTPVITLMFCVLFYKL
VTHVDQMKLNQHRKIYKKKFILDLFPNTQYMIQIKNLKKHYKKDKPILDDLDLDVKNGQI
LGLLGPNGCGKSTLLNILSLELKRNDGQIIILGSYIDEFSPMIQGLDLGYCSQYNILRQK
LKVEEHLNFISVIKGMTPEQIKQKKEWLMEALDLKRYGDKRAETLSEGNKRKLCLAMSLM
RQPKLLILDEPFTGVDPLGKRQIYQVLKSLKDITIVLSTHSIEEAEALCDRIVIMQQGKF
QEDLTVTELSKRNERLYRIKLVLQDQLMAAQVEEELKTLKDFKYVKDAEYLNNDMHHVLI
LREQNDNQKNSENETIIEDQAAFGVDEPNPYQSQQIDQTQSLVSEFEDNSMQVLKVSDDS
QVQITSTHNILEAMMKLEDLKKAKEIIDYKVYKSSFEEVFSYVQKAKSSVRKINIQ