Identifiers and Description

Gene Model Identifier

Contig19598.0.0.g10

Standard Name

DDXH1

Aliases

Contig19598_0_0_g10

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYMR080C7.003455847728069e-40NAM7 SGDID:S000004685, Chr XII
I from 429627-426712, Gen...
T. thermophilaTTHERM_007263007.999697430377842e-40phage head-tail adaptor, putat
ive family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19598.0.0.g10(coding)
ATGTAACGAAAATAAAAAAAGGGCAAGAATTTTGTTAGAAAACCTATCTCAGGACAACAA
ATTTTCCCAAACCCAAATATAAGCTCAAACTAAACTGAAGAGCGCAAAGGAAACCAGCGT
GAAGAAATTAAATCATATGAGCAAGTTTTCTAGGGAAACTCATGGGCAGATGGTTAATAG
CAACAGCCTGTTTAGCAAGTTCAATAGCCTATAATCATTTAAGATGTGTATGAGAGGATT
GGAATATTTCTTAACGGTAAAAAGCTTAGCACTTTGCCAAGAGTTGAGGGAAATTGCAAC
TTAAGAATTTTAAAGTCAAGATTGAATTTCAAATTTGACTATTACTTTACTTCGCCGACT
GCTAAGATAAGGAAATCCGAAGAACCTTAACATTGTGTTGCAGAAATTTTAGGCAATGAG
GGGAAAGAGATAAGAATTGAGCAAGATTTTCTCGTTATTCCAAATAAATTCCCGAATACT
GTTTCATATGTAAAAACTCTCTAGGCTTTTCTTCAAAACGAACATTCAATCAGCCAGGCT
ATCGAAAGGCCCCTGAAAACTGTCAACTTCAAGTTTGATGATACCGTGACATCAGCTATT
TCATGCAGGCTAATCCTTTAATTGAATAGAACTGATAATATGCATGAGAAGCAGCAATTA
ATAATTGAAATTCCATATAAAGATTAAATGGCACCAAGATACACAGCTATAGGATGTGTA
TACAAAATACAGATTGGAGCGAGAGGCCATTGCACAGTTCTTGTGGATATTAACATTCGA
AACCCAGATGCTAAAAGTGATGAGGGAGAGGGCAAGCAGCTCCTTCCATAAAAGGATCAT
GAACTGTATTAATCACATCTACAGTATTGCATTCTAAAGCTAAACAAGAGTTTCTTCAGG
CAAATGACCACTTTAGAGAAATTCTAAGCAGTGGGTAAGCCATCAACTGAATTCATAAAA
AATGCCATCTTAAATTGCGAACCTCAAAAGTCTATTTCAAATGAGGAGCCCTAGGATGTG
TTCGTTAATGGATTGCCAAAGACCTTCTCTAACTCACAATTCAAAGCAGTTTAAGAAGCT
AGGGTTGAGAGATTGAAATTGATTTAAGGGCCACCTGGTACAGGTAAAACATTAGTTACA
TGCGCAATTGTTGCTAATTGGTTTAAGATGAATCCCGAAGAGCAAATCTTGATATGTGCT
CCATCCAACGCCGCAGCAGATTTAATAGCAGAGAGACTTTAACAAATCGATATACTCACA
AACAAGTTTATCAGATTTTATTCAGAGTCCAAGGAAGATATTTTCAATTTAGACCCAGAG
AAAGTTAAACCTTTCACCATCATGCATAGAATGATATTTATGACGAATTAGCAAAAAGAG
GAAGAATCGAGTTAAATGCTTAATACAAGACATCTTTAGGATGTAAAGCAATAAGTAGAA
TACTATTTCAGTGACTTCAATTATTTTGAAAATAATGGCGGTGATAAACACATGAAAAAA
TTGGTTTTTGAAAATGGTTGTGTACCCTTTGAAAACTTGCTTCAATTCAATAGGATGAGA
TACTATCACATGGCAAGTTAATATGATCTCAATTAAATAGCACCTTTCGGTATAAACTAT
GAACTCTATTAAAATTTTGGCTTTAGAAAAAGAGAAAGAAATATTAACAATCAGCTCACA
GTGCTAGGTATGGATATTAATGGTATTCGAAATATGAGTAAACAAAACTTTGAAAGCTTT
ATCGATACAAAATAGAAATTTGAAAGAAGAATCATTGATCAAACACCAATAATCATTACA
ACATGTAACAGCAGCTGTGAAAAGAGGCTTAAGGATAAGAAATTCAAAAAAGTCATCATA
GATGAGGCAGCACAGGCAACAGAAGTAGAAACCTTGCTTCCAATCATAAATGCAAAACAG
GTGGTCTTGATTGGTGATCACAAATAGCTAGGACCAGTTATTGACACTAAATTAAACGGT
CCAGATTCTCTATTCAAAAGACTTATTGAAGGAGGCTATCCACACATTATGTTGAGTTCT
TAGTACAGAATGCATCCATTCTTACTCCAGTTACCAAATAGAATGTTCTACAATAATAAG
ATTGAGAATGAGTTCATTTTCTCTTACCAAAATTTCTTCATTCACAAAGATAGACCTCTA
CTTTTTGTAGATGTTGACGATGAAGAAACTAGATATGGAAGTTCTTTTTACAATGAGGGA
CAAGCTGTTGCTGCCTAACTCCTTTACAAATATTTGACAACCACTAGGGGTCTAAAATAA
TCTCAAATCGGTGTGATCTCTCCCTATAATGGTTAAACTTAAAAGCTAAGAGAGTTGATC
AGCTTTGATCCTAATGTAGTGAACACAATCGACTCGTGGTAGGGCAAAGAGCAAGATTTC
ATTATCTTCACAGCAGTTAGAAACAATTTACAAAGTATCGGGTTCTTGAAGCAAGAAAAC
AGAACTAATGTAATAGGCAATGTCTATCTCTTGATAGAAAATGGAGAGACTATTTGA


>Contig19598.0.0.g10(protein)
MQRKQKKGKNFVRKPISGQQIFPNPNISSNQTEERKGNQREEIKSYEQVFQGNSWADGQQ
QQPVQQVQQPIIIQDVYERIGIFLNGKKLSTLPRVEGNCNLRILKSRLNFKFDYYFTSPT
AKIRKSEEPQHCVAEILGNEGKEIRIEQDFLVIPNKFPNTVSYVKTLQAFLQNEHSISQA
IERPLKTVNFKFDDTVTSAISCRLILQLNRTDNMHEKQQLIIEIPYKDQMAPRYTAIGCV
YKIQIGARGHCTVLVDINIRNPDAKSDEGEGKQLLPQKDHELYQSHLQYCILKLNKSFFR
QMTTLEKFQAVGKPSTEFIKNAILNCEPQKSISNEEPQDVFVNGLPKTFSNSQFKAVQEA
RVERLKLIQGPPGTGKTLVTCAIVANWFKMNPEEQILICAPSNAAADLIAERLQQIDILT
NKFIRFYSESKEDIFNLDPEKVKPFTIMHRMIFMTNQQKEEESSQMLNTRHLQDVKQQVE
YYFSDFNYFENNGGDKHMKKLVFENGCVPFENLLQFNRMRYYHMASQYDLNQIAPFGINY
ELYQNFGFRKRERNINNQLTVLGMDINGIRNMSKQNFESFIDTKQKFERRIIDQTPIIIT
TCNSSCEKRLKDKKFKKVIIDEAAQATEVETLLPIINAKQVVLIGDHKQLGPVIDTKLNG
PDSLFKRLIEGGYPHIMLSSQYRMHPFLLQLPNRMFYNNKIENEFIFSYQNFFIHKDRPL
LFVDVDDEETRYGSSFYNEGQAVAAQLLYKYLTTTRGLKQSQIGVISPYNGQTQKLRELI
SFDPNVVNTIDSWQGKEQDFIIFTAVRNNLQSIGFLKQENRTNVIGNVYLLIENGETI