Identifiers and Description

Gene Model Identifier

Contig5986.0.g18

Standard Name

DDX6

Aliases

Contig5986_0_g18

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005226509.997093137033517e-262DEAD/DEAH box helicase family
protein
SGDYDL160C9.997093137033517e-262DHH1 SGDID:S000002319, Chr IV
from 171930-170410, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5986.0.g18(coding)
ATGGAAACAACCAACTCCGACGCCAAGCCTAACACCACCACCACAGCCACAACAGTAGCT
AAAGCCCCACCAAGAGACACCAGATTCAAGACCGAAGATGTTTAAAGCACCAAGGGTCTT
ACTTTCCAAGACTTTGGACTCTCAGAAGAAGTCTAATTGGGTATCTATGAAATGGGATTC
GAGAGTCCCTCACCAATTCAGGAGGAGACAATTCCCCTTGCCTTAGAAAATAAGAACATC
ATTGCCAGAGCTAAGAATGGAACCGGTAAGACTGCATCCTACTCCATTCCCATCATTCAA
AAAGTCGACACAAGCAAGAATCAGATTCAAGCTTTGGTCCTCGTTCCCACCAGAGAACTT
GCCATGCAGACTTCCCTCGTGATCAAGGAACTCGGCAAGCACAAAAAGATAGAATCCATG
GTTTCAACCGGAGGTACATCAGTAAAAGAGGATATCTATCGCCTCTATCAGACCGTGCAT
GTGATTGTTGGAACCCCAGGAAGAATTTTGGACTTAGCCTCAAAGGGAGTCGCCAACCTT
GAAAATTGCAAGATGCTAGTTTTGGATGAGGTCGACAAACTTCTTTCTATCGACTTCAAA
ACCATTGTTGCCAGAATCATTGAGATCATGCCAAAGAGTAAACAGATTATGTTGTTTTCA
GCAACATATCCAATGGAGATAAGAGAGTTCTAGAATAAGTACATTCAAGAAGCTATTTTT
ATCAACCTTATGGAGGAACTCACACTTAAGGGAGTCACCTAGTACTATGCATATCTTGAA
GAAAGGGAGAAGCTTCATTGCTTGAACACTTTGTTCTCCAAGTTAGAGATCAATCAGGCC
ATTATCTTTTGTAACTCAGCTAAAAGAGTTGAATTACTTGCAAAAAAGATTTCTCATTTG
GGATATTCTTGCTTCTACATTCACTCTAAGATGCAGCAAAACGACAGAAACAGAATCTAT
CATGACTTCAAAGCCGGAGAAACAAGATGCCTAGTATGCACAGATCTTTTCACAAGAGGT
ATCGATATCATGTCCGTGAATGTCGTGATCAACTTTGATTTCCCTAAGTACTCCGAGACC
TACCTTCACAGAATTGGTAGATCAGGTAGATTTGGACATCTTGGTCTAGCTATTAACTTC
ATTACTGAGGATGATAAGACCAACTTGTTCACTATTGAAGATGAGTTGAACACCAAGATT
AACCCTATTCCTTAGGACATCGACAAAAACTTGTACACTGTCTGA


>Contig5986.0.g18(protein)
METTNSDAKPNTTTTATTVAKAPPRDTRFKTEDVQSTKGLTFQDFGLSEEVQLGIYEMGF
ESPSPIQEETIPLALENKNIIARAKNGTGKTASYSIPIIQKVDTSKNQIQALVLVPTREL
AMQTSLVIKELGKHKKIESMVSTGGTSVKEDIYRLYQTVHVIVGTPGRILDLASKGVANL
ENCKMLVLDEVDKLLSIDFKTIVARIIEIMPKSKQIMLFSATYPMEIREFQNKYIQEAIF
INLMEELTLKGVTQYYAYLEEREKLHCLNTLFSKLEINQAIIFCNSAKRVELLAKKISHL
GYSCFYIHSKMQQNDRNRIYHDFKAGETRCLVCTDLFTRGIDIMSVNVVINFDFPKYSET
YLHRIGRSGRFGHLGLAINFITEDDKTNLFTIEDELNTKINPIPQDIDKNLYTV