Identifiers and Description

Gene Model Identifier

Contig12468.0.g66

Standard Name

DDX56

Aliases

Contig12468_0_g66

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR276C1.999981404597394e-31DBP9 SGDID:S000004266, Chr XII
from 696830-695046, Geno...
T. thermophilaTTHERM_005791500.000000000000001999258566166494hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12468.0.g66(coding)
ATGTCGGCCTTCCTAAAGCAAGTTAAAATCATTAATGAACTTGCCAAGGGTGTTCAGACA
CTCAAGCAGTTCGTTTACCCCTCTGTTCTATAGAAAGAAGCTATTCCCGTGCTAAGAAAG
AAAAAGAACAGTAAAAATGTGATTATTAGGTATTCAATGATGAGTGGTGTCAAGCTGACT
ATTTTATTGCCAGTTTTAGATTAATTACTCAGATCAGTCATCGCTGATGTTAAAACTGAG
AAAGATCAAGCTCATCATGTTCTCATTTTATGCCATAGTAACGCAAGATGCGGGGAATTG
GAGGAATTTATTAAGCAAATTACAACATTCTGTCAGGATATTATTGAGACAGTGGGTCTT
TACTCAGGAGATAACTCTGAAAATATGATTGCTTTAAAGAAAAGTATGAATATTGTATCA
CCCCAAGGAGCAAGTGACATGAAAGCATTATACAAGAGTAGATGCAAGGTGTTCATCAGC
ACTCCCAACCAAGCCCTCCATCTGTTGAAGAAAGAAGGCTTTAAAAACACAAAATGCACC
TCCTTAATTGTTGACAAGATCGACATGCACGTCGCTCTAGACTTAAGCAGTGAATTACTG
GAGATAACTAAGTACAATTTAAGTCCATTATTCAAAACTATTATTACTACAAACTTCAAG
GAAGATTAGAAAGATGATGAGGTGTTCTAAGGGTTGAAGAAGGCATTGTGTGGGGACTAA
AAAGCAATCATAATTTAGGTTAATGATGATCATAGAGTAAAAAGTAAATTCGAGAGACTT
GAACATTACTATGCATTGACTCAGACTTAATTAGACAAATTCGTGTTGCTATTTACATTC
ATCAAATTGGGGATCTTGGATGGTAAAACCGTGATCTACACCAATGATATAATTTAAGCT
TACAGAATAAAAATATTCTTGCAAAGATTCCATTTAAAGGCTTTCGTGCTCTCCCCAGAG
TTGCCTAAGAATCAAGCCAAGTCACTTATCCATTTCTTCCACATTGGACAGTTCAGTATT
ATGATAGTAATGCAAAGTGGCTACTCACATCAACCATAATTCAAAAATGTGCAACATGTT
GTCAATTTTGATGCTCCAGAGAAATACAACCAGTACAAGGAAGCAGGTTAATAAATTGAA
TATGATAATGGCAGTGAATTGACACTCATCAGCCCAGATAAAGATCTTGAGAAATTAGAT
TTATATAGACGTAAACTTATGAAGTCATTCTAGTCCCAAAACATGCTAAAGTGCATCCCA
ATTATGTGGTAGGAATTAATGAAAATAAAGTCAAGAGTAGAGGATGTGGTAAAGACACTT
GACAACAAGCGTGTCAAAGAAGAAAAAACTAACGAATTTAAGAAGCAATTGCTCTCTAAC
AAGAGACTCAAGGATTATTTTGAGAAAAACCCACAAGAAAAGGAAATTCTGCTTAATGAT
ATGGCTAAGAGTGACACATCACAGAGAGATAGATATTTGTTCAAGCATTTAGGCTATTTA
CCATCTTATGCTCTACCACAGCAGGTCATGGCTGTCACACCAGAGCAGATTCAATTATGC
ACAGTGGGAACACAAAGTATTTTAAGTGGAAGTTTCCAAGGTTTCGTAAGCACTGATAAA
AATCTAACAGGCCACAAAGGTTTGAACACTCTCGACGGTTTCGCTGATGCAAGTGAGGCT
CAGTGCAGTCTGATTTAAAACTTAGCTTCATTGCCTGCTACTATCCAGAGATATCATGCC
ACTCAAAATGAGGTCAAGGAACAAGAGCAAGATCAAAAGGATCAAGCATTCGCTGGGGAA
GATCCAGCTATGGTTAACTATGAATCATTGGAACCAACTAGCGGTAGAAAACTGTGGAAA
TTAAGACATCACAAGAGCATCAAGAAGAAGCTCAAGCCACACAAGAATGGTTTCATTGGT
CATTGA


>Contig12468.0.g66(protein)
MSAFLKQVKIINELAKGVQTLKQFVYPSVLQKEAIPVLRKKKNSKNVIIRYSMMSGVKLT
ILLPVLDQLLRSVIADVKTEKDQAHHVLILCHSNARCGELEEFIKQITTFCQDIIETVGL
YSGDNSENMIALKKSMNIVSPQGASDMKALYKSRCKVFISTPNQALHLLKKEGFKNTKCT
SLIVDKIDMHVALDLSSELLEITKYNLSPLFKTIITTNFKEDQKDDEVFQGLKKALCGDQ
KAIIIQVNDDHRVKSKFERLEHYYALTQTQLDKFVLLFTFIKLGILDGKTVIYTNDIIQA
YRIKIFLQRFHLKAFVLSPELPKNQAKSLIHFFHIGQFSIMIVMQSGYSHQPQFKNVQHV
VNFDAPEKYNQYKEAGQQIEYDNGSELTLISPDKDLEKLDLYRRKLMKSFQSQNMLKCIP
IMWQELMKIKSRVEDVVKTLDNKRVKEEKTNEFKKQLLSNKRLKDYFEKNPQEKEILLND
MAKSDTSQRDRYLFKHLGYLPSYALPQQVMAVTPEQIQLCTVGTQSILSGSFQGFVSTDK
NLTGHKGLNTLDGFADASEAQCSLIQNLASLPATIQRYHATQNEVKEQEQDQKDQAFAGE
DPAMVNYESLEPTSGRKLWKLRHHKSIKKKLKPHKNGFIGH