Identifiers and Description

Gene Model Identifier

Contig240.1.g137

Standard Name

DDX55

Aliases

Contig240_1_g137

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003166803.9982216364827585e-104DEAD/DEAH box helicase family
protein
SGDYFL002C3.9991157591502974e-89SPB4 SGDID:S000001894, Chr VI
from 146934-145114, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig240.1.g137(coding)
ATGGAATCAAACACATAAAAAGATTATACTTGGTCTGACTTGCCACAACTAGACAAGACT
CTCTGTGAGCACATCAAGACTGAGATGAAATTTGATAAAGTCACTAAGGTTTAGAAAGCT
GTTATCCCATTATTCTTATCAAATAAGGATGTGTGTGTGAAGGCATGTACAGGTTCAGGA
AAGACTTTAGCATTTACCATTCCATTAATCCAGCATTTAATGACTTTACAGAAAACAAAG
CAAAAATTCGAAAATAATGAAGTTGTAGGATTAATCTTTGCTCCAGCAAGAGAGCTAGCC
TTCCAAATTCATAATGTAGTGAAACAGTTCGAGCATTTGATTCCAGACTTCAGCATCAAT
TTCTTAACTGGTGGAACTAAATTAGAGTATGATGTTCAAAGAATAAAAGAAAAAGGTTGC
AATGTTGTGATTGGAACTATTGGAAGAATATTCGATTTATACTCGAAAGACTTAATCAGC
TTCAAGAAGATTGAAGTGTTAATCATGGACGAAGCTGATAGACTACTTGAAACTGGAAAT
GAAAATATGCTTCAGCAATTATTAGGTGCTCTACCCAAGCAGAGAAGAACTGGTCTATTT
TCAGCTACAATGACTTCTTAACTAAAATCACTTATAAGAATTGGTATGAGAAATCCATAT
TTTGTTGATGTTAGAGTTGAGATGTCTGGAATATTCTCTACTGAAAAAGATAAGGTTTCC
ATTCAATAGTTTGACTTGCACGGAGATAAACTTGTTTTGAACAAATAAATATAGGACATC
AACGAGGTCCCTTAGAATCTTGAGAACTTTTATACTTTAATCGACCATTAAGCTGACAAA
ATGAGACACTTGCTTGGATTTTTGAAAAATTTAAAACCAGTTCGTATTATTATTTTCTTT
GGCACTTGTGCTTCTGTAGACTTTCACAATTTGATCTTAAGGTTCCTAATCAATGCTAAT
ATTTACAAGTTACATGGTAAGATTGATCAGAAAAAGAGAAGCAAGATTTATTAAGCTTTC
AGAACACAAGATCACGAAGAAATGGAGTCTCATCAACTATTGCTTACTACCGACTTGGCT
GCTAGAGGAATCGACATTCCAGAGGTAGACTGGATCATTTAATACGATCCACCTCAAGAC
AGTGATTAATATGTACATAGAATTGGCAGAACAGCTAGAGCTGGTAAATCTGGATAATCG
CTTATTTTTCTCTAAAAGCATGAAGAACCCTACGTTGAATTCCTAATGAAGAAGGGAGTA
AAGATTGATTTACTCTAAATCAACACCAAAGAGGAAATTAATGAGGAGATTAAGGCTTAA
GTTCAAGGTGAAATGAAGCAAGATAGAGACATTATTGATAAAGCCTCAAGCGCATTCGTG
AGTTTCGTGAGATACTACAAAGAACATTCCCTGCAATACATCTTTGTAATGAATTAATTG
GACATAGGAGAAGTAGCAAACTCCTTCTACTTGTTCAAGGTCCCAAGAGTCAAGGAGATA
TTGGGTAAATCTTTGAGAACTTTCCATTAAGATAATTCTTTCGCTGTTGATGAAGTGCCA
TACAAAGACAAAAACAAAGAAAAGCAAAAAGAGAAGAAAGCAGGAAAATGA


>Contig240.1.g137(protein)
MESNTQKDYTWSDLPQLDKTLCEHIKTEMKFDKVTKVQKAVIPLFLSNKDVCVKACTGSG
KTLAFTIPLIQHLMTLQKTKQKFENNEVVGLIFAPARELAFQIHNVVKQFEHLIPDFSIN
FLTGGTKLEYDVQRIKEKGCNVVIGTIGRIFDLYSKDLISFKKIEVLIMDEADRLLETGN
ENMLQQLLGALPKQRRTGLFSATMTSQLKSLIRIGMRNPYFVDVRVEMSGIFSTEKDKVS
IQQFDLHGDKLVLNKQIQDINEVPQNLENFYTLIDHQADKMRHLLGFLKNLKPVRIIIFF
GTCASVDFHNLILRFLINANIYKLHGKIDQKKRSKIYQAFRTQDHEEMESHQLLLTTDLA
ARGIDIPEVDWIIQYDPPQDSDQYVHRIGRTARAGKSGQSLIFLQKHEEPYVEFLMKKGV
KIDLLQINTKEEINEEIKAQVQGEMKQDRDIIDKASSAFVSFVRYYKEHSLQYIFVMNQL
DIGEVANSFYLFKVPRVKEILGKSLRTFHQDNSFAVDEVPYKDKNKEKQKEKKAGK