Identifiers and Description

Gene Model Identifier

Contig7520.0.g66

Standard Name

DDX54

Aliases

Contig7520_0_g66

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004496305.998305401373361e-129Type III restriction enzyme, r
es subunit fami...
SGDYDL031W3.0007755961645985e-116DBP10 SGDID:S000002189, Chr IV
from 394217-397204, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7520.0.g66(coding)
ATGAACTCAGATTTATTTATGGAGCATGACGCCCATCTCCCAGAACTTCAAAACAAAGAT
CCAGCTCTTGAATTAAAAAAGAAGAAGAAGGCAGGCGGTGGAGCATTTGAGGCTTTCAAT
TTATCCACTTTCCTGTATAAAGCAATTAAACAGAAAGGTTATAACTTACCTACTCCCATC
CAAAGAAGGGCCATTCCTGTGATCTTAGAAGGCTTCAATATTATTGCTATGGCTAGAACT
GGTAGTGGTAAAACAGGTTCTTTTGTCATTCCCATTATTGAGAAATTGAAAGCGCATAGT
AAGGTAGTCGGAGCTAGATGTATCATTTTGTCACCAACAAGAGAAATCGCCATGCAAACT
GCCACATATTTTATGTCTCTGGCTAAATACACAGATCTCACTTACGCCTTAATTACAGGA
GGTAGTGACATGGAAAACTAATTTGAAAGATTGCTACTAAATCCCGATATTATTATCGCT
TCACCAGGTAGATTGATGCATTGTATCTAAGAAACTGGACTCTCACTTTCTCAAGTTTAG
TTAGTCGTATATGATGAGTGCGATAGATTATTTGAGCTAGGTTTTGCTGAATAACTAAAG
TCCATCACTGACAGAATGCCCAAGTCAAGATAAAGTTTACTTTTCTCGGCTACTATTTCA
TCTTAGGTTAAGGAATTCGCTCTTTCTGGTATCAAAGATTACAAGATGGTTTAGGTTGAC
AGAGATTCTAAGTTGAGTGATGATTTGAAGCTGTAGTTCATGGTTGTAAGAACTGGAGAA
AAGGCAGCCACACTACTGTATATTATGAGAGAGCTTATTTAAGATGTCAATGAGAAGCAA
TAATCAATTATCTTCGGTGCGACTAGATATCACGTAGAGTTCTTGCATGAGCTTGTAACT
AGAGCTGGCTTTAAGTCAGTATTTATTTATGGTGCTATGGATTAAAGATCAAGAGAGGAG
CGTCTTAACATTTTCAGAGCTAAGAAAGTTAACTTCCTTATAGTCACTGATTTAGCAGCC
AGAGGTATTGATATTCCCTTCCTCTCTAATGTTATCCACTACGATTTCCCAACTAAAATG
AAATTATTTATTCACAGATCTGGTAGAACTGCCAGAGCCGGTTAGAAAGGTACCTCATAT
TCAATCATTACCAAGAAAGAACTTCCTTATATGCATGACCTGAGTATCTTTGTAGGCAGA
AAATACTTTGATAAGCCTTCTGAGAATCTTGAAATGAATGAACTGTTATTAAACCCAATG
CATATTTGCTTTGGCCGTCTTCCTCAACACACAGTAGATGAGTACATGGAACTTTACGCT
AATCTCCTACATTCACATGAAACTGCTTTGTAACCACTTTAGAAATCTATGGAGCTATCT
CTGAATAAGTACAACAAAACCAGAGACCCAGCATCTATGAGTGGTGTTTATGCTGCAAGT
AAATTACAGGAGAGTGATATTCATCCACTTTTACGTCTTACTGTTGATTAGAAACAGGTT
GATTTTATGAAGTTTAAGGATCAACTCAAGTCTTTCAAGCCAAAATAGAGCGTGTTAGAG
CAAAGCATAATCAAAACTATGGACTATCAAAAGATCAATAAATTCTAAGACGCTCTGTAA
CTTCAAGACTAGAAGTATAGGTAGATCTAAGAAAGAAGAGAATATCATAAGGAAGTTCAA
GCTAAGTTTGACTAGGAGCAAAAGGTCCTTGATTAAAAGATTATTGAGATGAAGACTAAG
GAACAGGAGAACAATTCTAAGCTATTGAAGAAGAGAAAGAGAGCTGAAGCTACAAGTGTT
GCTTAAGAGGAATAGGAAATTCAAGGGAACTCAAAAATTAAAGACCAAATCAGTAAAATG
AGTAAAAAACGCAGACTAAAAATCTAGAAAATTCTAGAAGATAAGTCTCTCTCAAATTTT
GAGAAAGAATCCCTCATTGAGTAAATCAAGGATGATGGTCTGAACATCAAAAGATAGAAG
AAGTCTTTCGCAGGTGACTTCAGAGCGAGTGGCTAATATATTAGCAATGAGAAAGGAATG
GATGGAGAAGGAGGAGATATGGCAAGCAGAGCTGGAAAGTCCTCACTCTGGAATGATGAT
GAGAGAAACTTCTTGGATGACGTTACATTGAACTTGATAAACGACGATGACGAAATGCTA
CAGCATATGAAGGGAAAGACTGTTATGAAGTGGGACTCAAAGAAAAAGAGGTACGTTACC
AAGAAGATTGATGGAGACCGTAAGATAGTCAAAGAAAAGAGAAATGAAGCAGGTGTCAAA
ATTACCAATAAAAATGCTGATAAAACTATGGATTAACAGTTTTATAAGAAGTGGATGTAG
AAAACTCATTTGAAGCTACAAAATGCTGGAGATATGGAAGACTCCAAGATCATTGAGAGA
GCCAAAAACAGCAATGAAAGCAGAAGAATGATGAAATCTTTCAGAAAGGGTCACGCAGAC
TTAAATAAGGGAGAGGACGCAAGATCCACAAGCAAACTTATTGAAACTAAAAAGAAAAAG
ATGATGGCTTCAATAAAGAAGAGTGGAAAGCAAGACAGAGGAAGCTCCAACAACCCTAGC
AATGGCAAGTATGGAGACAAGCAATGGAATAAGATTGTATAGAAGAGTAGACCCACTAGA
AGCATGCTAGTCACTAAGAATGTAGGAAGAGGTGGTAGAGGAGGCAGCAGAGGTGGCAGC
CGAGGTGGCAGAGACAGCAGAGGAGATAGAAGTAGTAGTTTTGGTGGTGGAAGCAGAGGC
GGAAGAGATAGTGGCAGAGGCGGAAGAGATAGTGGCAGAGGTGGAAGAGGAAGTAGCAGA
GGTGGTAGAGGTGGAAGAAGATGA


>Contig7520.0.g66(protein)
MNSDLFMEHDAHLPELQNKDPALELKKKKKAGGGAFEAFNLSTFLYKAIKQKGYNLPTPI
QRRAIPVILEGFNIIAMARTGSGKTGSFVIPIIEKLKAHSKVVGARCIILSPTREIAMQT
ATYFMSLAKYTDLTYALITGGSDMENQFERLLLNPDIIIASPGRLMHCIQETGLSLSQVQ
LVVYDECDRLFELGFAEQLKSITDRMPKSRQSLLFSATISSQVKEFALSGIKDYKMVQVD
RDSKLSDDLKLQFMVVRTGEKAATLLYIMRELIQDVNEKQQSIIFGATRYHVEFLHELVT
RAGFKSVFIYGAMDQRSREERLNIFRAKKVNFLIVTDLAARGIDIPFLSNVIHYDFPTKM
KLFIHRSGRTARAGQKGTSYSIITKKELPYMHDLSIFVGRKYFDKPSENLEMNELLLNPM
HICFGRLPQHTVDEYMELYANLLHSHETALQPLQKSMELSLNKYNKTRDPASMSGVYAAS
KLQESDIHPLLRLTVDQKQVDFMKFKDQLKSFKPKQSVLEQSIIKTMDYQKINKFQDALQ
LQDQKYRQIQERREYHKEVQAKFDQEQKVLDQKIIEMKTKEQENNSKLLKKRKRAEATSV
AQEEQEIQGNSKIKDQISKMSKKRRLKIQKILEDKSLSNFEKESLIEQIKDDGLNIKRQK
KSFAGDFRASGQYISNEKGMDGEGGDMASRAGKSSLWNDDERNFLDDVTLNLINDDDEML
QHMKGKTVMKWDSKKKRYVTKKIDGDRKIVKEKRNEAGVKITNKNADKTMDQQFYKKWMQ
KTHLKLQNAGDMEDSKIIERAKNSNESRRMMKSFRKGHADLNKGEDARSTSKLIETKKKK
MMASIKKSGKQDRGSSNNPSNGKYGDKQWNKIVQKSRPTRSMLVTKNVGRGGRGGSRGGS
RGGRDSRGDRSSSFGGGSRGGRDSGRGGRDSGRGGRGSSRGGRGGRR