Identifiers and Description

Gene Model Identifier

Contig12363.0.g65

Standard Name

DDX51a

Aliases

Contig12363_0_g65

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam04851 ) Type III restriction enzyme, res subunit
  • ( pfam08328 ) Adenylosuccinate lyase C-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000369801.9992982665753866e-121Type III restriction enzyme, r
es subunit fami...
SGDYHR065C7.996458382256093e-94RRP3 SGDID:S000001107, Chr VII
I from 229037-227532, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12363.0.g65(coding)
ATGTCAAGTTTACCTATATTGACCACCTTCAAGTCACTCAACCTTGATAACTGGATAATT
AAAAACCTAGAAGAAATTGGTATCAAGGCTCCCACTTAAATTCAGATAGACTCTTTGCCA
CATATATTAAAGGGCAAAAACATCATTGGATGTGCATAAACTGGAAGTGGAAAGACTGCT
TGTTTCGCTCTCCCCATGCTTCAAAAACTAGCAGCAGATCCATATGGAGTATTTGGCTTA
ATACTCGCTCCATCAAGAGAACTTTGCATGTAGATCAAGCAGTCGATTGAATCCTTTGTG
GGATAAAATATGAACATCAGAGTATGTGTGTTGGTTGGTGGTGTAGACTACATGAAATAA
ATCAAGGAACTTCAGGAAATACCACATATAATTATTGCTTGTCCAGGCAGAATGGTGCAT
TACCTTGATAATGACCACTATGGTCTCAAGGATTACTTGTAAAATTTACAGTTCTTAGTA
TTCGACGAGGCTGATAGAATGTTAACTGAGGATACAATGAAAAGCGATTTAGTCAAAATC
TTAGAAATTCTGCCTAATGAAAGATAAACTCTACTTTTTTCTGCTACTATGGTTTAGAAT
TATGACAGAAACATAAGCAAAAATTTAATATTTGGAGAAGACAATAAAAGAGAGATGGTT
GGAATTGGAAACACAGAAGCAGCTAATGAAGAATTCTAAAAGACAGTCTAGAATTTGGAT
TAAAAAATTGTCTTCATTCCAGAAAATGTTAAAGAAGCTTATTTGATATACCTCCTCAAG
AATTAAAAACTAAAGAAACAGTAATAATGCATTATTTTCACATCAACTTGCAAAAATTGT
CACTTTTTGGCTATGCTATTATAAGAATTAGAATTTGATGCTACATTTATTCATTCTCAG
TTGAATTAGAGAAAGCGTCTAAATAACTTGGCTAGATTTAAATCAAACTACACCAAGATC
ATAGTTGCTACAGATGTAGCCTCTAGAGGTCTCGACATGCCTTTAGTGCAGACTGTAATC
AATTTTGATATTCCAAAGAACCCCAAGGATTACGTGCATAGAGTCGGTAGAACTGCCAGA
GCTGGAAGAGGTGGTAATTCAGTCTCACTTGTCACTTAATATGATATTGACCTGATCTTA
GCTTGTGAAAAGTACGTTGGTATTAAGATTGATAAGCTAGAATTAAATGAAAAGGAAGTC
CTTGATGATATCAACCACATAATGAAAGTGATGCAAGTAGTGAGAATTAAAATGGCTGAG
TAAGGCATCAATGATATGTTTGAAGAATTCAAAGAAAAGAAGTCGCTTATCAGAGACTAG
AGAAAGGGTCCAAGTGGAGCTCAGTAATTTGGATTAAGCACTGTCAAAAGCAAGGAGATT
CTCGCTGAAAAGTCTAAGAGCAGGAAGAGAGATGAGAAATAGATTGACAAATAAACTACA
AAAACCAATAAGCAAGCAAAGAAGTGA


>Contig12363.0.g65(protein)
MSSLPILTTFKSLNLDNWIIKNLEEIGIKAPTQIQIDSLPHILKGKNIIGCAQTGSGKTA
CFALPMLQKLAADPYGVFGLILAPSRELCMQIKQSIESFVGQNMNIRVCVLVGGVDYMKQ
IKELQEIPHIIIACPGRMVHYLDNDHYGLKDYLQNLQFLVFDEADRMLTEDTMKSDLVKI
LEILPNERQTLLFSATMVQNYDRNISKNLIFGEDNKREMVGIGNTEAANEEFQKTVQNLD
QKIVFIPENVKEAYLIYLLKNQKLKKQQQCIIFTSTCKNCHFLAMLLQELEFDATFIHSQ
LNQRKRLNNLARFKSNYTKIIVATDVASRGLDMPLVQTVINFDIPKNPKDYVHRVGRTAR
AGRGGNSVSLVTQYDIDLILACEKYVGIKIDKLELNEKEVLDDINHIMKVMQVVRIKMAE
QGINDMFEEFKEKKSLIRDQRKGPSGAQQFGLSTVKSKEILAEKSKSRKRDEKQIDKQTT
KTNKQAKK