Identifiers and Description

Gene Model Identifier

Contig20704.0.g65

Standard Name

DDX46b

Aliases

Contig20704_0_g65

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002951004.000134262463081e-139CLN3 protein
SGDYNL112W2.9993408039826107e-81DBP2 SGDID:S000005056, Chr XIV
from 413639-414911,41591...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20704.0.g65(coding)
ATGAGAGAAGGCAGCAACGTTGCTGCAAATGATGCTGCTATGAGAGAAAGAAACGATGAG
CATCAATCCCTAGATGAAGCTTCTGAGTACAGAAAAGGTTCAGGAATAAGCTTTGCAAGA
TCCTCTAACATATTGAGTTCAGTGAACAAATATGGAATGCCCACAGTCTTGCCAAGTCAT
TAGAAGCCGCCAGAGGATGAGGATCCTCTGGACGCTTTCATGCGAGAGATTGAGGGTCAA
GCCATTTAAGATAAACAAGTGACATTACAACACTAAAAAGAGCTTGAAGAGAAAGCATGG
AAGAAACTTCTCAAAGAAAAATAGCTTCTAGAAAAACTTCAAGGAAAGACTGATTAGAAA
GAGTCAATTGTGGAAACAATAGACAATACCTCAGCAATGAAAGTGAAGCAAGTTGAGCAA
TTTTAAAGCAAGAATTTCAAGTACGATGAAGATTCTGAGGAGGAAACTCAAAAATATTTG
AAAAGATCTCACTTAGGAAGAGGTCATTAAAAACACAAAGATAGCGAAAAAGATGAGGTT
ATGAGCGATGGCATTGATGATTCCGAGTAAGCCTTATTAGACAGACAAGAAGCACTTTTG
GATGGTAATGGGAATCTAGATTATGAAAAGTTAAGATAAATGGAGAAAAAGGGAATTCAA
GCCTTAAATACACTAGATCACACACAGATAGAATATGACAGTTTTGAAAAGAATTTCTAC
TAAGAACACCCAGATATTACAGCTATGAGTTTTGAAGATGTTAATTATACTAGGAGGCAA
TTGCAAGTGAGAGTGTAAGGAGAAAGAGTGCCAAAACCAATCACAGAATTCAAGCATCTC
TTAGTTGATTAATGGATCCTGGACAGAATCAAGAAAATGAATTATGTTGAGCCCACACCC
ATATAAGCCCAATCTTTGCCTTGCTCGCTTTCAGGAAGAGATATTATAGGCATTGCAAAG
ACAGGTTCAGGAAAAACTTTAGCTTTTTTGATTCCTATGTTGGTTCACATTTTGGATCAA
AGACCACTTGAGAAGAATGAAGGGCCTATAGGCTTGGTCATGGCTCCAACTAGAGAACTT
TGTTAGCAGATATACAATGAGTACAGAAAGTATTGCAAGCCTTATAATGTCAATGTTTTG
CCTATATTTGGAGGAGTTTAGTAGCATTAGCTTTGGAAAGACATAAAAGCTGGAAAGAAT
GAAATAGTAATTGCCACTCCTGGAAGATTGATAGACATGATAAGGAAGAAAGCGTTTAAC
TTATCATCAAGGTGTACTTTTTTAGTGATTGATGAGGCAGACTAAATATAAACTTTATTC
TTCAGCGCTACATTCAAGAATAAGGTTCAGGAACTATGCTCTGACATTTTAACAGATCCA
ATAAAGATTGTGGTTGGAAGAGAAGGAGTATCAAATGAAGATGTTAGTCAAACAGTTTTA
ATCTTAAAAAAAGACATCTATAAATTTCAGTGGCTTATTGAGAGCTTGGATAACTTCCTA
GGCAAAGGAGGACAAGTGCTTATATTTGCTAATTAGATATAAACAGTAGAAGGACTAGAA
AAGGATTTAGCTCCAGTCTTCAAAAATAAGGGCCTTGCCTGTCTTCATGGTGATAAGACT
CAATTTGATAGAACCCACATAATTGATAAAGTTAGGAAGGGGGAAGTTAACATATTGATC
TCAACAAACGTAGCATCTCGTGGTTTAGACATACCGACTATTAAAACAGTGATAAATTAC
GATTGTGCGAAAGATAAAGAAGATCATATTCATAGAATAGGGAGAACTGGTAGAGCAGGT
GACAAAGAAGGAGTAGCTTACACACTTATAACAAAGAATGAAACTGGAAAAGCAGCTATG
TTAGTGAAAATTCTCGAGAACTCAAATCAAGTCGTAAGTGAAGAACTTGAATAGCTAGCC
ATGTCAGATGGAGGGTTTAGAAAGTCGAGAGTAACTATAGGAGTGAAAAACTTTAACATG
AAAATCAACATTGCCAAGGAGTAGAAAGAAATGAAGAAAAATGCTAGAAAGATAGGTGAC
AGGACAGGAATAGGATTTTCAAAGAGTGATAAAAAAAATGGGGGGAATTCTGATGAAGAT
GGAAATGGAAATAAAATGAGTGCATAGTAGAAAAAGAGAATGGATAAAGCTTAAGAAGAA
GAGATGATCAATTAGAAAATTGCAAGAGAAGCTGAATTGTACTTTAATCGAGGTGGTCTT
GGAGGTGGCACATTTGGAAGCACTGAAAATTAAGGCGATGTTTTTGATAACATGGATTAA
TTTTCAGATAGACTGAAGGATTAAATGAAAGCGAAATTCTCATAAAATTTCATTTCCTCA
GGTAAAGTGTAGACAACAAGTAAAGAGGCAACTGTTACTTTCATAAAGAAAAGTGTCACA
GGTGATGGCTAATAAATAGCATAAGTTGAAAAAGAAGTGCTAAAACTTGATGAATATCAA
CCAAAAATTTTAGAGAGTTAAAGTTCAAGCTTTTACTAAGCTATACCTCCTCAGAGTAAC
TTAGGAGTTAAATTCAGCGAAGAGCCCTAAAATTTTGTTAATAAATCAAACTTTTCTCTC
GATAAACTCTATGAAGATATTAAAAATAGAGCCAATAACTCAGCATAAACGAAACCAGAC
TAAATCAATAGACTCTCACAAAATATGTGTAAGCTTTCCAAAAATTCAAGAAACAGATCC
TCAAGTAGTAGCAGAAATAAAGATGAAAGGAAGCATAAATAGAGATAAAGATCTTTTTCA
TCAAGTTCATCTAGATCAAAATCCAGAGATAAGAGAGACAGAAAGAGTAGCAATAGACAT
CCTCATCAGTCTAGTAGAAGTAGAAGATCAAGAACTAGAAGTAGAGATAGAAAAAGCAGA
GACAGTAAAAGCCATAGAAGGTCGAGATCATCATCGCATCACAGACATAGAGACAGAAAA
TCATACCACGATAGAGATAGAAAGAATGGGAATTCAAGAAGTGATAGTAGAGACAAATAT
AGAAAGTAAAGATCGAAATCAAGGTCAGTTAATCGTGAACCATAATAAGCCAAACCTAAA
AGAATAAGCAAATGGGATATAAAGCCTGATACAGTTTGA


>Contig20704.0.g65(protein)
MREGSNVAANDAAMRERNDEHQSLDEASEYRKGSGISFARSSNILSSVNKYGMPTVLPSH
QKPPEDEDPLDAFMREIEGQAIQDKQVTLQHQKELEEKAWKKLLKEKQLLEKLQGKTDQK
ESIVETIDNTSAMKVKQVEQFQSKNFKYDEDSEEETQKYLKRSHLGRGHQKHKDSEKDEV
MSDGIDDSEQALLDRQEALLDGNGNLDYEKLRQMEKKGIQALNTLDHTQIEYDSFEKNFY
QEHPDITAMSFEDVNYTRRQLQVRVQGERVPKPITEFKHLLVDQWILDRIKKMNYVEPTP
IQAQSLPCSLSGRDIIGIAKTGSGKTLAFLIPMLVHILDQRPLEKNEGPIGLVMAPTREL
CQQIYNEYRKYCKPYNVNVLPIFGGVQQHQLWKDIKAGKNEIVIATPGRLIDMIRKKAFN
LSSRCTFLVIDEADQIQTLFFSATFKNKVQELCSDILTDPIKIVVGREGVSNEDVSQTVL
ILKKDIYKFQWLIESLDNFLGKGGQVLIFANQIQTVEGLEKDLAPVFKNKGLACLHGDKT
QFDRTHIIDKVRKGEVNILISTNVASRGLDIPTIKTVINYDCAKDKEDHIHRIGRTGRAG
DKEGVAYTLITKNETGKAAMLVKILENSNQVVSEELEQLAMSDGGFRKSRVTIGVKNFNM
KINIAKEQKEMKKNARKIGDRTGIGFSKSDKKNGGNSDEDGNGNKMSAQQKKRMDKAQEE
EMINQKIAREAELYFNRGGLGGGTFGSTENQGDVFDNMDQFSDRLKDQMKAKFSQNFISS
GKVQTTSKEATVTFIKKSVTGDGQQIAQVEKEVLKLDEYQPKILESQSSSFYQAIPPQSN
LGVKFSEEPQNFVNKSNFSLDKLYEDIKNRANNSAQTKPDQINRLSQNMCKLSKNSRNRS
SSSSRNKDERKHKQRQRSFSSSSSRSKSRDKRDRKSSNRHPHQSSRSRRSRTRSRDRKSR
DSKSHRRSRSSSHHRHRDRKSYHDRDRKNGNSRSDSRDKYRKQRSKSRSVNREPQQAKPK
RISKWDIKPDTV