Identifiers and Description

Gene Model Identifier

Contig18987.0.g89

Standard Name

DDX46a

Aliases

Contig18987_0_g89

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004204209.997093137033517e-262DEAD/DEAH box helicase family
protein
SGDYBR237W8.996145899952539e-121PRP5 SGDID:S000000441, Chr II
from 691969-694518, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18987.0.g89(coding)
ATGGAAAGTAGAGTTCTGAGGAATGACAAAAGAAGGGATGATCGTGACCACAGCAGAAAG
AGGGATAAGGATTCTTAAAGGCGTAGTGATAGAAGAACTTCTTCATAGTCCCCAGAGAGT
CGTGACAAAGACCGACATAGGAATGATCGGGAAAAAAGTGGCAGGAGTCACCACCGCAAG
TCAAGGTCTCCTTCAGACATAGTAAAAAATGATAAAAAATCATACAAGAAATCTAAAAGT
AGGGGAAGAGATGATAGCAGAAACAGAACTCACAAGAGTAGGAGATCAAGATCTAGAGAC
TCAGATCGTGATTACAAAAGAAGGAGACACGATTCTTAAACTAGTAGGTCATCTAGGTCC
AAAAGTGATAGTAGAGATAGAAGGCACAAAAGAGACAAAAAAGACAAGAAGCATAAGAAG
GATAAGAAGCACAAATCCAGAAAGTCATTGGAGAGAGAAGAGCAAAAGAAAATGCAAGCA
AGATTAGCAAAAGCCAGACTACTTGCTTCATTAGCTGACAAAGGTATTTAAGAAAACAAT
CGAAGGGGATTGGATGAAGATGATTTAGATATGGCTGAAATCGATGTTGATTATCAAGTT
AATACTGATAATTAGCAAATAGCGTAACCAGAACAAATTTAGATATAAAAACTTGACACA
CCACCTAAAGCTTTAGAACAAGTACCAATCGACAATTAAAATCCTGAAGCCATTCAACCT
ATAGTATCTGTAAATGGTTCTGATCAACTTGAAAATTTGAAGAAACCTTCAATTTAAAAT
ATTGAGAAAGAAATTAAAATAATCAATAGGGGAGAATCATTGAAGTCACAAACTCTAACG
TAAAACTAATAACCAAAGTCTAAATTCTAATTTATAGAAGAGTCTCTTCCCTAAGCCACT
AAAAAGTCAGATGAAGTTTAAGAGGAAGGCTAAATTGTTGATAAGAGTGAGCCCAAAAGT
TTCTTAAACCTTGGTAATGATTCTACTACAATGAATGGTATAAGTAAAAATTAAGCTTAA
ACTTAATCTAGGCTATCATCAAAACTTAATGCTTTTTCAAAGCAACAAGATGATCCTGCA
TCTTTAATCTTTAAAGCATCAAATATTAGTCATAGATTCACAGTTGCTCCTGTTTAGCAG
GTCGAAGAGGAAGAGGATCCATTTGATGTTTATATGAAGCAAATTGAATAAGATGCTGTT
GCCTAAGAAGATGTAAAACATCCAAACTAAACTGACTATGACGATTATGGTTATGAGAAT
AACATGGATGATGAAGAAAAAGAAGAACAAGATTAAAGTTCTGCTCCAAAATAACAGCCC
TTAAACGTCGTAACATTTGATGATATTATGGATTTAGATGAAGGAGATGCAGATAATAAC
ACTTTTAACGATATAAACGAGGAAGATTTTCATAAATAGTTCATCAAAGAACTTAAGAAA
AAAGAAATGCTTGAGAAACTTCAACAAGAGAGTAATTAAGTGCTCTTCAATGACGATGAT
GATAAGTACATTATGGACTTTGAAAAGGTTGAAGAGGAAGCTGAGTCTTATCTTGAAAAG
GAAAAGAAAAGAGCTGAAAGACAAAATCTAAAATTAGTCAATCATGACAACGAAACATAC
GATAAACTTAATAAGAATCTGTATATAGAAACCAAAGAAATTTCAAGAATGACTGACAAA
GAAGTTTAAGAATTTAGAAAGTTAAATGGTGACATCAAAGTCAGAGGCTTAAAATGCCCC
AAACCAGTCTCAAGTTGGTATTAATGCGGCTTACCCGATGGAGTCTTGGAAGTAATTGAA
AGAAAGAATTTTCAAAAACCATTTCCTATATAATGCTAATCACTTCCAGCAATTATGTCA
GGGAGAGATGTAATTGGAATTGCTGAAACAGGAAGTGGAAAGACTCTTGCCTATGTTTTA
CCAATGATTAGACATATTAGAGATTAAAGACCCCTTGAAGAAGGAGAAGGAATGATTGGT
CTTATCATGGCTCCTACAAGAGAGCTTGCCTTCCAAATCTACAAGGAGTCTAAAGCATTT
GCAAAAGCATGCGGAATTAGAGTTGTATGTGTTTATGGAGGTGCAAACGTTGCTGGCTAA
TTATCAGAACTTAAAAGAGGAGCTGAAATTGTTGTGTGCACTCCAGGTAGAATGATTGAT
GTTCTTTCGACATCTAATGGGAAAATAACAAACCTTAAAAGATGCAGTTATATTGTCCTT
GATGAAGCTGATAGAATGCTTGATATGGGGTTCGAGCCATAAATATCTAGAGTCATGCAG
AATGTCAGACCTGATAAATAGTGCGTTATGTTTTCAGCAACTTTCCCTAGATAAATTGAA
AATCTTGCTAAAAAGGTTCTCACATCTCCTATTGAAATCGTTGTTGGAAATAGAGGATAG
ACTTGTGCAAATGTAGAGCAATTTGTAGAAGTGTTAAATTAGGAAGATAAATTCTGGAAA
TTAATGGAGCTCCTTGGAGAATGGTTTGAGAAGGGAAGCATTCTAATTTTTGTTGATAAG
TAAATTGAAGCCGATGAACTATTTAAGGAACTGTATAAAGTTGGCTATAAAGCACTTGTT
CTTCATGGTGGTTAAGACTAAACTGATCGTGAATTTACAATACAGGATTTCAAAGATAGA
GTGAGAAACATTATGGTTGCTACTAGTGTTTGTGCTAGAGGCCTTGATATTAAGCATATG
AGATTGGTAATTAACTATATGTGTCCAAATCACACAGAAGATTATGTTCATCGAGTTGGT
AGAACTGGAAGAGCAGGAACTAAGGGAACTGCTTACACTTTCATAACTCCTGATGAGTGT
CAATATGCAACTGATTTAATAAGAGCTCTAGAAAATTCAGGCAATTAAGTCCCAGAAGAA
TTAAAAAAACTAGAAGAATCTTACTAAAAGAAAATTGAGGAAGGTGAAATCGAAAAGAAA
AAGACCAATGTTGGATATGTTGGAAAAGGTTTTGAGTTTAACGATAAAGAAAAAAATAAA
GTCAAGGATTTCAGAAAGGAACTCTCTAAAGCTTATGGAATGGGAGGTGAAGAAGAAGAA
GAATTAGCAGACGATATAGTAAAAAATCCATCAAACAAAGATGATGAAAGATAAAAGCAA
GAAGAGTAACATCTTATTTACTTGCTTGAGAAAGATCCAAATGCTAGAAAAGCAGCAATT
GAGGCAGGTAATCAAGCAAGTAGAAATGCTCTTCAATAAGGACTTTCTCATGATGAAGCA
TCAAAGGTAGCCAAGGAGGCGATGATGCTCGTCTTAGCTTAATACAGACCAGCAACTGTA
ACAATAGAAAAAGGACTAGAAAGTGTGCTTAATATCAGAGATTAATTCGTTGAGAAAGAA
AATGAAAGAAACAATATTTTCACTGCTGAATTTGAAATCAACGATTATCCATAATAAGCC
AGAAATAAAGCAACTAACAAAGATTTCGCTTAGCAAATCGTAGAAATGACTGGGTGCAAA
ATAATAATCAAAGGTAATTTCTATGAATTTGGAAGAAAACCACCTGCAGGGTAAAGGAAA
TTGCATCTTTATATTGAAGGTTCTAGCAAGTAGGAAGTTGCAAATGCTTACAAAGAAATC
AAAAGATTCATCGAAGAGGCTTCAATTAGTCATGCACAAGGTGGCTAAAATCTCCAATTC
TCAGGTTCATTCGCAAAGTACTGA


>Contig18987.0.g89(protein)
MESRVLRNDKRRDDRDHSRKRDKDSQRRSDRRTSSQSPESRDKDRHRNDREKSGRSHHRK
SRSPSDIVKNDKKSYKKSKSRGRDDSRNRTHKSRRSRSRDSDRDYKRRRHDSQTSRSSRS
KSDSRDRRHKRDKKDKKHKKDKKHKSRKSLEREEQKKMQARLAKARLLASLADKGIQENN
RRGLDEDDLDMAEIDVDYQVNTDNQQIAQPEQIQIQKLDTPPKALEQVPIDNQNPEAIQP
IVSVNGSDQLENLKKPSIQNIEKEIKIINRGESLKSQTLTQNQQPKSKFQFIEESLPQAT
KKSDEVQEEGQIVDKSEPKSFLNLGNDSTTMNGISKNQAQTQSRLSSKLNAFSKQQDDPA
SLIFKASNISHRFTVAPVQQVEEEEDPFDVYMKQIEQDAVAQEDVKHPNQTDYDDYGYEN
NMDDEEKEEQDQSSAPKQQPLNVVTFDDIMDLDEGDADNNTFNDINEEDFHKQFIKELKK
KEMLEKLQQESNQVLFNDDDDKYIMDFEKVEEEAESYLEKEKKRAERQNLKLVNHDNETY
DKLNKNLYIETKEISRMTDKEVQEFRKLNGDIKVRGLKCPKPVSSWYQCGLPDGVLEVIE
RKNFQKPFPIQCQSLPAIMSGRDVIGIAETGSGKTLAYVLPMIRHIRDQRPLEEGEGMIG
LIMAPTRELAFQIYKESKAFAKACGIRVVCVYGGANVAGQLSELKRGAEIVVCTPGRMID
VLSTSNGKITNLKRCSYIVLDEADRMLDMGFEPQISRVMQNVRPDKQCVMFSATFPRQIE
NLAKKVLTSPIEIVVGNRGQTCANVEQFVEVLNQEDKFWKLMELLGEWFEKGSILIFVDK
QIEADELFKELYKVGYKALVLHGGQDQTDREFTIQDFKDRVRNIMVATSVCARGLDIKHM
RLVINYMCPNHTEDYVHRVGRTGRAGTKGTAYTFITPDECQYATDLIRALENSGNQVPEE
LKKLEESYQKKIEEGEIEKKKTNVGYVGKGFEFNDKEKNKVKDFRKELSKAYGMGGEEEE
ELADDIVKNPSNKDDERQKQEEQHLIYLLEKDPNARKAAIEAGNQASRNALQQGLSHDEA
SKVAKEAMMLVLAQYRPATVTIEKGLESVLNIRDQFVEKENERNNIFTAEFEINDYPQQA
RNKATNKDFAQQIVEMTGCKIIIKGNFYEFGRKPPAGQRKLHLYIEGSSKQEVANAYKEI
KRFIEEASISHAQGGQNLQFSGSFAKY