Identifiers and Description

Gene Model Identifier

Contig21312.0.g80

Standard Name

DDX43a

Aliases

Contig21312_0_g80

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam04851 ) Type III restriction enzyme, res subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL112W5.99913252163138e-160DBP2 SGDID:S000005056, Chr XIV
from 413639-414911,41591...
T. thermophilaTTHERM_005692905.998558726299043e-153DEAD/DEAH box helicase family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21312.0.g80(coding)
ATGCACAACAATTACGACAAGTAAGCTTACGACAACCTCGGAGATAAATTAGCACGTATC
GACTGGAGCAAGGAGGAACTCAAACCATTCAAGAAGGACTTTTTAGAGGAGCATGCCGAT
ATTACTGCTAAATCAGAGGTAGAGATTAAGAAGTTTTTGGATGAACATTGCATCACAGTG
AAGGGCACAAACGTCCCTAGACCACTTGCAACTTTCGAAGAAGCAAACTTCCCCAAGCAC
ATCATGGACACATTGAAGACCTGCGAGGGCTTCGTCAAACCAACTCCCATCTAAAGTCAA
GGATGGTCAGTAGCATTGTCCGGAAGAGATATGATCGGAATCGCTGAGACTGGTTCCGGA
AAAACTCTTTCGTTCTTATTGCCCGCCTTGGTTCATGTGTATGCCTAGGAGGTACCAAAG
AGAGGTGATGGCCCTATAGCTCTTGTTTTGGCGCCAACACGTGAACTAGCCATGCAGATT
GAAACCCAATGCAGGAAATTCGCTTAAGCCTGTAAAATTCAATCTTTAGCAATCTATGGC
GGCGTGCCCAAACATGAGCAAAAAATCGCACTAAGGGCAGGAGTGGAGATTCTGATCGCA
ACACCAGGAAGACTGTTGGATTTCATGGAGCTTGGTACTGTGAGACTGAACAAAGTCACT
TATCTTGTACTTGATGAGGCTGATAGAATGTTGGATATGGGATTTGAGAAGCACATCCAG
AAGATTCTGAGCTATGTTAGACCAGACAGACAAACTCTCATGTGGAGTGCCACCTGGCCA
AAAGAGGTCCAGGACCTAGCTAACTCATATTGCAATGTGAAACCAGTTCAAATTCAAATC
GGTAATCCAGGTATAACTGCCAACAAGCGTATCGATTAGATTATTGACATCTGTGAAGAA
CATGAGAAGTACAACAAGTTCAGAGATTACGTTAAGTAAATCAATGATGGCTCAAAGATT
CTCGTGTTCTGCGAGACAAAGAAGGGCGTTGATGAACTTACCAAGCAAATGAGGTACGAC
GGTATGCACGGTGTCAAAGGAATCCATGGTGACAAGGCTCAATACGAAAGAGACTTTGTG
ATCAAGGACTTCAAATCCGGAAAATGCAACATCCTAGTCGCTACCGACGTTGCTTCCCGT
GGTCTTGATGTGAAAGATGTGATGTACGTAATCAACTACGACATGCCAAAGCAAGTTGAG
GACTACGTTCACAGAATCGGTAGAACCGCCAGAGCAGGTACTTCTGGAGTTGCCTATGGG
TTATTCACAAGAGCCAACTACATGATCGCTAAGGACTTAGTCAAGCTACTCAAAGAAGCT
CAACAAGATGTTCCCGAAGGACTTTGGAACTATGTTGATCAAGCCAGAAAGAACAAGGAT
CAAAAGGGTCAGTACAGACAGTGGAGAAAGAATGATAGATCTAATACTTTCGGTGGTGGA
TACTAAAACAATGGTAGCAAGAACTACGGAAGCAACAATCAAAGCAGCGGTGGATACGGT
AGTGGTGGATATGCCGGTGGCTACCAAAGACCTACTTACTCTGCAGGAGCAGGAGGTTAT
CAAGGCAGCAACAACTTCAACTAAGCTGCAACCACTGGTTTCCAACCACAAGCCCAATCA
AGCTTTTCAAATTCAACTTGGAATAGAAATGACAAGAGTGGTTCAACTGCTCCCAGTCAA
TTCCAACACTCATATAGAGACTAGAACAGAATTGATTCTACAGCAGGAGGTGCAAAGACC
TTTGATGCTACTGCTCTAGTGAACACTATGATCGGAAGTCAAAGCACTAACAGTGGCAGC
TACAACGCCTACAATCAAGGTAGCAATGGTTACAACAAGAACTTCGGTGGAAACTAAGCC
GCTTTCCCAAACAACTCACAGCCATACTACCCAAAAGCCTACGGTAACTCAGGCTTCAAC
TCAAATGCCACTGAATTCAAAAAGCCTTCTCTTTTGGATTCAAACCAGCAATGA


>Contig21312.0.g80(protein)
MHNNYDKQAYDNLGDKLARIDWSKEELKPFKKDFLEEHADITAKSEVEIKKFLDEHCITV
KGTNVPRPLATFEEANFPKHIMDTLKTCEGFVKPTPIQSQGWSVALSGRDMIGIAETGSG
KTLSFLLPALVHVYAQEVPKRGDGPIALVLAPTRELAMQIETQCRKFAQACKIQSLAIYG
GVPKHEQKIALRAGVEILIATPGRLLDFMELGTVRLNKVTYLVLDEADRMLDMGFEKHIQ
KILSYVRPDRQTLMWSATWPKEVQDLANSYCNVKPVQIQIGNPGITANKRIDQIIDICEE
HEKYNKFRDYVKQINDGSKILVFCETKKGVDELTKQMRYDGMHGVKGIHGDKAQYERDFV
IKDFKSGKCNILVATDVASRGLDVKDVMYVINYDMPKQVEDYVHRIGRTARAGTSGVAYG
LFTRANYMIAKDLVKLLKEAQQDVPEGLWNYVDQARKNKDQKGQYRQWRKNDRSNTFGGG
YQNNGSKNYGSNNQSSGGYGSGGYAGGYQRPTYSAGAGGYQGSNNFNQAATTGFQPQAQS
SFSNSTWNRNDKSGSTAPSQFQHSYRDQNRIDSTAGGAKTFDATALVNTMIGSQSTNSGS
YNAYNQGSNGYNKNFGGNQAAFPNNSQPYYPKAYGNSGFNSNATEFKKPSLLDSNQQ