Identifiers and Description

Gene Model Identifier

Contig17817.0.g49

Standard Name

DDX31b

Aliases

Contig17817_0_g49

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam13959 ) Domain of unknown function (DUF4217)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004551404.001839059848271e-97DEAD/DEAH box helicase family
protein
SGDYMR290C1.99927841627239e-68HAS1 SGDID:S000004903, Chr XII
I from 851591-850074, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17817.0.g49(coding)
ATGCTATTAAACGTAGATTTCAACGCAAACATAAAGCCAAAGCCTTCATAACAGAATGGC
GAGAGTTAGGGCAAGCAAGAGAAAAACAGAGATAAGTATAAGAGAAGCAAGCAGAAAATC
ATAGATAGAAAGTTTAACAGGAATTAAAACTAGAATAGAGATGACCAGCAAATGGAAAAT
AACAATAGAAGCAATATATAAAGTTAGCAAAGAATCTAATAGTAAAATGACATAATCACT
GAAAATCAATAGAAAGGCTTCAGAACATTGAATGAGGGAAATTAAGCTTAAGAAGTCATC
TCAGTAGCAGATCAATTGGTAGCTCCAGTTCCTCAATTCAATAATTAGAAATAAGATTTC
AACTAAGTTAAGAGATTCAATACTATCAGCGATAGATCAAAGCAAATTAGCAAAGATAAA
TCCCTATTGCAAAAGTCAACTATAAAGTCTAGACAACAAAAAGGCGATGAAAGCGATGAT
TACGATATCGAAATGAATCCAATTGTAAAATCAAATCCAGTTGCAACAATTAACAAAACT
GTACCAGCTCAAGTTGCTTAACAACAAGATTAACCATTAATCGTGGCAGAAAAAGAACAA
GTGCAAACATAAAAGTAGGCTGCTCCTATTCCAGAATAGAAATAGGTTGCATAGGGTGCT
GCTGAAGAGGACTTAACTCAGAGGAAAAATAAATCTGCTCCTCTAGAAGAATAGGTACCT
TTAGTAGATGAACAGGCTGAACAGCAAGAAGCTGAGGTATTTACTGGTGAAAAATTCTCT
GACTTACCATTAAATGACAAACTATAGCAGGTATTAAAAGAGAATGGCTTTGAGCAGTTG
ACAAACATCCAGAAGAGTGCTATCCCAGTTATCTTGAAAGAGAGAAATGTGATTTTGAAG
GCGGAGACAGGAAGTGGTAAAACCCTAACTTACTTGATCCCACTCCTAGAATATCTCTCA
AATCAGTCTCTAAACAAGGAGAAGATTACTAGAGATAACGGTACTTACTGTATCATATTT
TCACCCACAAGAGAGCTTTGTGTTTAGATTGAGATTGAATTGAAGAAACTTTTGAAACTT
TTCTATTATGTCGTCGCTGGTACCATAACAGGAGGAGAAAATCCATAGAAAGAAAAGTCA
AAATTAAGAAAAGGTATGACTGTGATTATATGCACACCAGGAAGATTCTTATATCATTTG
CAACATACATCTTCTATCAACCTCAGTCATTTGAGCTATTTAATTTTTGATGAGGCTGAT
AGAATTTTGGATTAAGGTTTCGATAGAGAAATGAGTTAATGTTTGAATGTAATTAAGAAG
AAGGTTCCACATAAATTTTCAACTCCCCTTGACAGTGGAAATTTCTGGAGTGATACTCTA
AAAGTAAACTTTGTATCTGCTACTTTAAACAGTAAAGTTGAGTCACTAGGTTAAAGGCTT
ATGGAAAACTATTCAAAAGTAGGTTTCGAAAAGAATCTTAATGAAGAGGAAGATCAAATT
GCACAAATTCCAAAATAAATCTAACAATACTTTATGGAAGTACCAACTCAATACAGATTA
CTATACTTATTAGCCTTTCTATATGCTCATCAAGATGAAAAGGTTTTAGTATTCATAAGC
AACTGTGAGTTAGTTAATTTCCTCTATCATTTAGTTAATAACTTGAATTGGAATAACTTT
GGTAAAAGAGACGATTTCTATCAAACCTAAGGTACTGAAGGCGTTGAAGAGGAAAAAGCT
TAAGCTTTATGTGGAGGTCACATTTACAAACTCCATGGTGATATGGATCACAATGAGAGA
AAAAAGAATTTCTTCGGATTCGATAAGGCAGATTCAGCAATCTTGATTTGCACTGATGTT
GCGTCCAGAGGTTTGGACTTCAAGCATGTGGAATGGATTTTATAATATGATTTATCTAGT
AACATTAAGGAGTATGTTAATAGAGTCGGTAGAACAGCTAGAATTGCAACTACTGGTTCA
TCCCTTTGTTTTATCATGCCTTAAGAAAGAGGATACATTAAACACTTGAAAAATAAGCAT
CATATTGAACTACATCAAAAGACAAGATTCGAAATGATCAAGCAATTCCAAAAGAAAATT
CAAGTGCTAAACCCTAAAAAGAGTATGTACTTTAAATAGCTCAAAAATATCGAAGATGAA
GATGAAATGCAAGAAGCAATTCACAGATTGAGGCATTTGCTTAGATACACTGTGGAGTAA
GATGGTTTGAATCTCATTAATATGGCTTAAATTGCAAAGAACTCTTCAACTAGAGCCTAT
GCTGGGCATGCTCATGATATGAGAAGCATCTTTGAAATAAACAACTTGAACTTGACTGAA
TTCGCAAGGTCTTTCGCTCTCTACAAAAACCTTATGTCTGTAGGTCTACCTGCTTATGGA
AAGAAAGAAGATTCCAAGAAGAAAATGCTCTCAAAGCGTGACAAAAAAGATGGTTCATCT
AAATCAGGGCCAACATCAGGCGCTACAGTTTCATTCGATGATGGCCAACTTTACTCCAAG
AGGTTGAAGAAATCACAACAGAAGGGATTGGAGAAGAAACTTGGCTCAATTAGTGACGAC
GCATAGAAGGTGAGAGTCATGGGTATGATCAGTGACTTGAAGAGAGCTGTGTATGTCAAT
GAGGATAAAGTCGCACTAAGAAAGAGGAACTTCGAGAAAGCAAGGCACAGTGTCGGCAAG
AAAGTATTAGATGAATTTATTTGA


>Contig17817.0.g49(protein)
MLLNVDFNANIKPKPSQQNGESQGKQEKNRDKYKRSKQKIIDRKFNRNQNQNRDDQQMEN
NNRSNIQSQQRIQQQNDIITENQQKGFRTLNEGNQAQEVISVADQLVAPVPQFNNQKQDF
NQVKRFNTISDRSKQISKDKSLLQKSTIKSRQQKGDESDDYDIEMNPIVKSNPVATINKT
VPAQVAQQQDQPLIVAEKEQVQTQKQAAPIPEQKQVAQGAAEEDLTQRKNKSAPLEEQVP
LVDEQAEQQEAEVFTGEKFSDLPLNDKLQQVLKENGFEQLTNIQKSAIPVILKERNVILK
AETGSGKTLTYLIPLLEYLSNQSLNKEKITRDNGTYCIIFSPTRELCVQIEIELKKLLKL
FYYVVAGTITGGENPQKEKSKLRKGMTVIICTPGRFLYHLQHTSSINLSHLSYLIFDEAD
RILDQGFDREMSQCLNVIKKKVPHKFSTPLDSGNFWSDTLKVNFVSATLNSKVESLGQRL
MENYSKVGFEKNLNEEEDQIAQIPKQIQQYFMEVPTQYRLLYLLAFLYAHQDEKVLVFIS
NCELVNFLYHLVNNLNWNNFGKRDDFYQTQGTEGVEEEKAQALCGGHIYKLHGDMDHNER
KKNFFGFDKADSAILICTDVASRGLDFKHVEWILQYDLSSNIKEYVNRVGRTARIATTGS
SLCFIMPQERGYIKHLKNKHHIELHQKTRFEMIKQFQKKIQVLNPKKSMYFKQLKNIEDE
DEMQEAIHRLRHLLRYTVEQDGLNLINMAQIAKNSSTRAYAGHAHDMRSIFEINNLNLTE
FARSFALYKNLMSVGLPAYGKKEDSKKKMLSKRDKKDGSSKSGPTSGATVSFDDGQLYSK
RLKKSQQKGLEKKLGSISDDAQKVRVMGMISDLKRAVYVNEDKVALRKRNFEKARHSVGK
KVLDEFI