Identifiers and Description

Gene Model Identifier

Contig17328.0.g28

Standard Name

DDX31a

Aliases

Contig17328_0_g28

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004971509.997093137033517e-262DEAD/DEAH box helicase family
protein
SGDYMR290C9.997093137033517e-262HAS1 SGDID:S000004903, Chr XII
I from 851591-850074, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17328.0.g28(coding)
ATGGACACCAAGCTAATTCTGAAGAAACAGGACAAGTTAAAGCGCAAGCTTTAAGAAAAA
AAGAAGAAGCAGGAGAAAGACAATGAAGATAGTCTGAGGAAACAACGTATCTTGGCTGCT
GCTTAAGATTCTGATGAAGATAATGAGAGTGTTGAGGAGAAAGTTTAAGTGACCAAGAAT
GGCAAATAGATTCAAGGATAGTAAAAGCAGAATGTATAGCAATCACAGAAGAAGCACAAA
TAAGCTGAAAGTGATGAAGATAGCAGTGATAACGAAGAATTGAATGATTAAGAGTCATCT
GATGAGGATGAAGATCCAAGGGATAATGTTAAATTAAGATCAAGAAGTTAAAGCCAAGAT
GAGGTCGCTGCAGCTTAAAGAAGATCTAGAACTAACTCCAAGGATCAAACTTAATCTGCC
TTGAAAAATAGTAAATAGTCTATCAAGGAGGATGTTAAAGTAGAAGAGAACAAATTGAAT
GATGAGTACTTCTCTAATTTAGAGTTCAAGGACTTGCCCTTGAGTGAACAAACTCAGAAA
GCTATCGAATAATTTGGTTATAAGAAGTCAACTGAGATTCAGGCAAGATCAATCCCACAC
GCCTTGAACGGTCGTGATGTTTTGGGAGCTGCCAAAACTGGATCAGGAAAAACTTTAGCT
TTCATGATCCCAGCTGTTGAATTACTATACAAGGCTCAATTCACTTAGAAGAAGGGTACT
GGAGTAATTATTATCGCACCTACCAGAGAGTTGGCTATGTAAAATTATAAATGGGCTAGA
GATTTATTACAGTATCACTCTAAAACTCACGGTGTTGTTATTGGTGGTGCCAAAAGATCA
TCTGAAGCTAACATGCTGAAGAAGGGAGTGAACTTGCTCGTTGCAACTCCAGGTAGACTT
TTGGATCATCTCCAAAACACCCCAGGTTTCTTATTCCACAACTTGCAAATGCTTATTATT
GACGAGGCTGATGCTATTTTGAAGGTTGGTTTTGAAGAAGAAATGAATTAAATCATTAAA
TTATTGCCAAAGGAAAGAGTCACCTGTCTTTTCTCTGCTACTATGACAAAGAAAGTAGAA
GATTTGTGCAGACTTTCACTTAAGAACCCAGTCCTTATTGAAGTCAGCAAGGATTCTAAC
ACATCAACTGTCTCTAACCTCGAATAAGGATATGTTGTAATTGACCCAGCAAAGAAATTC
CAGTTGTTGTTCACATTCTTGAAGAAGAACCTGAAAAAGAAGGTTATGGTATTTATGTCA
TCTTGCAACGCAGTTAAGTTCTATTCAGATTTGTTAAACTATGTTGATATCCCAGTAAAG
GATATTCATGGTAAACAAAAGCAGCAAAAAAGAACCTCAACTTACTTTGAGTTTTGTCAA
GCTGAAACTGGAATTCTTCTTTGTACAGATGTTGCACAGAGAGGACTTGATTTCCCATCA
GTCGACTGGATTATTCAATACGACCCACCCGATGATCCAGAAGATTATATCCACAGAGTA
GGTAGAACCGCCAGAGGTGCCTCAGGAAAAGGTAGAGCACTTTTGTTCCTCCTTGAACAC
GAAATCGGTTTCCTCCGCTACCTGAGACTGTCAAAGATCAAGCCAAACGAATACGAATTC
CCAGAGAGCAAGCTAGCCAGCATTTAAGAGCAATTCATGAAGCTTATTGAGCGTAACTAC
TATCTTAACTGCTCTGCTAAGGACGGCTATAGATCGTTCTTGTAGGCTTACGCTTCACAT
AAACAGAGAGAGTTATTCGATGTCAATCAACTTGACTTGCAAAAACTTGCTTAATCTTTC
GGTCTCGCATCTCCTCCTAGAGTTAACTTAAACGTCAAAGTACAAGGTAGAACAGTCAGA
AAGAATAAACTTAAGGAGCAATTGGGTAAAAGAGCAAAGCCAGAATATAATAGAAGAGAT
AATAGTGCAGATGGTAGACAGTTCTCCTATTGA


>Contig17328.0.g28(protein)
MDTKLILKKQDKLKRKLQEKKKKQEKDNEDSLRKQRILAAAQDSDEDNESVEEKVQVTKN
GKQIQGQQKQNVQQSQKKHKQAESDEDSSDNEELNDQESSDEDEDPRDNVKLRSRSQSQD
EVAAAQRRSRTNSKDQTQSALKNSKQSIKEDVKVEENKLNDEYFSNLEFKDLPLSEQTQK
AIEQFGYKKSTEIQARSIPHALNGRDVLGAAKTGSGKTLAFMIPAVELLYKAQFTQKKGT
GVIIIAPTRELAMQNYKWARDLLQYHSKTHGVVIGGAKRSSEANMLKKGVNLLVATPGRL
LDHLQNTPGFLFHNLQMLIIDEADAILKVGFEEEMNQIIKLLPKERVTCLFSATMTKKVE
DLCRLSLKNPVLIEVSKDSNTSTVSNLEQGYVVIDPAKKFQLLFTFLKKNLKKKVMVFMS
SCNAVKFYSDLLNYVDIPVKDIHGKQKQQKRTSTYFEFCQAETGILLCTDVAQRGLDFPS
VDWIIQYDPPDDPEDYIHRVGRTARGASGKGRALLFLLEHEIGFLRYLRLSKIKPNEYEF
PESKLASIQEQFMKLIERNYYLNCSAKDGYRSFLQAYASHKQRELFDVNQLDLQKLAQSF
GLASPPRVNLNVKVQGRTVRKNKLKEQLGKRAKPEYNRRDNSADGRQFSY