Identifiers and Description

Gene Model Identifier

Contig803.1.g97

Standard Name

DDX28

Aliases

Contig803_1_g97

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006831601.9992138342796362e-97Type III restriction enzyme, r
es subunit fami...
SGDYPL119C7.998505003885351e-50DBP1 SGDID:S000006040, Chr XVI
from 326264-324411, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig803.1.g97(coding)
ATGTGGACTACAAAACTATGGACAAAATCTGTCCTTCACAATAAATAACAACTCAATTAC
CAATTATAAAACTATAAACTCTTCCAAAATTTGTAAATTTTAGGAAATCTTCAACAAAGA
TCAATTGGAATAGAAAATAGAGCACCCGTAAACCATGGCAATCCTTATAAAGACAAATTA
AGAGAAGGCACAAGTTCATCTTATACTTTCAAATAAGCTGAGAAAATGCAATAAGAAGAG
AGAAAAATGCACAATTTGACTTTCCGCAAGTTTAGACTCCTCGATGAAGTTGTTGATATC
TTAGAGAAGTAGTTTCAGGTTACGACTCCATCACCTATTTAACAATTAGCCATTCCTCAT
TTGTTATAGTCCAAGAGTGCTCTAATAGCTGCCTAAACAGGCACAGGTAAAACACTGGCC
TATACAATTCCTATAATTGATCAGTTAAAACGCTAGGAGATGGAAGCCTAAACAAGATTA
ACTATGCCTAATAAGCCAAGATCAATCGTTTTAGTTCCATCAAGAGAGTTAGCCATGTAA
GTACTGAATTCAAGCTTAAAACCCTTCACCTATGAAGTTCCTCTCAAATTCTTCAGCATC
TACTCTGGGTAAAGCCATAGAATAGAAACAGATAAATTAGAGAATGGTGTTGATGTACTG
GTTTCAACTCTAGATAGATATTTGTACAGAAGAGATGGTGAGAAAGTATTCATGACAAAT
GTTAGTAGTCTAGTTATTGACGAGTTGGACACTTTCCTAGATAGTGGTCATGAGAAAAAG
ATTAGAGACATTATTGAATAGTTCTTGACTGGAGCAGATAGATAAGGAATCAAGAAACAA
ATTATCTTTTCCACTGCAACTATGACATCTTAAATGGATGGACTATTGAAAGATTATTTC
CAAGATGATTTAAATTTCGCAAAATTGGTTGAGAAAAAGACACATATGAACCTTAGCAAT
TTAAAGCATGAATTTATTCAACTTGCTGATTTCGATAAAATTAAGCCATTAAAGTTATTA
GTAAAGGAATACAAGCAATATGCTTAAAAGAATGAAACTTAGTGCATAATCTTCTGTAAT
TCAGTTCAATCTGCTAGAGCAATAGAGCATGCCTTAGCTTAAGACAATTTTAAAACATGT
AGTTTACATGGTGAAATCCCTCCAAAAATGAGATAAATCAACTTTGACAAGTTCATGAAC
AAAAAAGCTGAAATCTTGGTTGCAACTGATTTGGCATCAAGAGGATTAGACGTACCAAGT
ATCTCCCATGTCATTAATTTTGATTTCCCAAAGTCCACTTCAGATTATTTGCATAGAGCT
GGAAGAGCAGGACGCGCTGGTAGACCAGGATTCGTTATGAGTTTAGTAAGAGAAAAGGAT
AGTCCCATATTGAATGAAATGAAGTTAGCTAATGAGTAGCAAGCTCCCTTAAAAATTAAA
GGCAGCGCTTACTCATTGAAAAATAAAGAAGTAATTATTGAAGAAAATAAATAATAAGGA
CTGGCTGTAAGTCTTGGTCAAAAGCCAAACTTGAAATAAGACTAGAAATATGTTGATTGG
ATAGAAGCTAGAAAATTAGGAAGGAAAAAGATAGAATGCTGCTAATGA


>Contig803.1.g97(protein)
MWTTKLWTKSVLHNKQQLNYQLQNYKLFQNLQILGNLQQRSIGIENRAPVNHGNPYKDKL
REGTSSSYTFKQAEKMQQEERKMHNLTFRKFRLLDEVVDILEKQFQVTTPSPIQQLAIPH
LLQSKSALIAAQTGTGKTLAYTIPIIDQLKRQEMEAQTRLTMPNKPRSIVLVPSRELAMQ
VLNSSLKPFTYEVPLKFFSIYSGQSHRIETDKLENGVDVLVSTLDRYLYRRDGEKVFMTN
VSSLVIDELDTFLDSGHEKKIRDIIEQFLTGADRQGIKKQIIFSTATMTSQMDGLLKDYF
QDDLNFAKLVEKKTHMNLSNLKHEFIQLADFDKIKPLKLLVKEYKQYAQKNETQCIIFCN
SVQSARAIEHALAQDNFKTCSLHGEIPPKMRQINFDKFMNKKAEILVATDLASRGLDVPS
ISHVINFDFPKSTSDYLHRAGRAGRAGRPGFVMSLVREKDSPILNEMKLANEQQAPLKIK
GSAYSLKNKEVIIEENKQQGLAVSLGQKPNLKQDQKYVDWIEARKLGRKKIECCQ