Identifiers and Description

Gene Model Identifier

Contig10050.0.g108

Standard Name

DDX24

Aliases

Contig10050_0_g108

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001312406.002971818577897e-50DEAD/DEAH box helicase family
protein
SGDYBR142W2.00017271388466e-38MAK5 SGDID:S000000346, Chr II
from 528317-530638, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10050.0.g108(coding)
ATGGACTCAGATAGTGATAGTCAACAAGATAATCAGGAGAAGCAATAAGTTATTCAGAGA
TAACCTACTCCTATAGTCCCCAAGAAGCAGGCAATTAAAAATTGGATGTAATTTGATATG
TCAGAGGAACTAGCTGAATCTCTGGTCGCAAACTAATTTGTGCAGCCTACTGATGTTTAA
GCATAAAGTCTGGTTTTCCTTAATGCACATGTTGATATGGTGATTGCAGCTAAGACAGGT
CAAGGTAAAACTCTGACATTCGGTATCCCCATCTTAGATTTACTGATTAAACGCCTCATC
AAGGACTAGTCAGGAGAACCTGAGGAATTCACCTCTATCAAGGCTTTGATAATGAGTCCT
ACTCGTGAGTTAGCAATACAGATTAAAGATCACATTTAAGCAGTCGTACCTGTTTAATAT
CAAAATAAGATTAAGCTATGTCCACTTGTCGGTGGTATGAGTATTTAGAAACAGGAAAGA
CTACTTTCCTACAACCCAACAATTGTGATCGCAACACCAGGTCGTCTCTGGGAGCTCCTG
AATGAAAGAATGAATCCATACTTGCAAAGTGCACTACCCATGATTGACGTACTTGTGCTG
GATGAGGCCGATAGAATGATCGAAGATGGGCATTTCAAGGAAATGAAATATATTTTGGAC
TATGTCTATAGCAAGAGAGTTGAATTCAAGAAGCTCAAGCTACTCAGGGAAAAGAACTTA
AATGCTGATGAGACAGATCCTAAAGTTTTGGAATAAAAGAAAATGAAGAAAGATATTATT
GATAGAGCAAAATCACAAAAGGACAACATGGTGATTAAGACCATAGAGACCAACAAAAAC
ATAAAATTCGACATGAACAAGGTAGTAGACCTCTACGACGAGAGTGAAATGTTGGAGGAA
ATCGATCCCGATGAGTTAATAGTTGAGGATGGTCATAAAAATGACGAAGAAAAGGAAGAA
GGAAAAGGCAAGGGCAAGAAACAGAAGAGATTGAGTCAGCAGCAATTGTCAAAGGAGCAG
GAAGAGAAATTCGCTGCTGAATATAAGAAAATGGGAGGCATTCAGCACATTATTTGTTCT
GCAACCATGACTATTGATCCAACAGGACGTATTACACCCAAGAAAGCCAAGAAAATCTTG
AAATCTGGACATAATAAACCAGAAGCAGTAGACACATTAGAGCAACTATGTAAGACCTTG
AGATTCAGAACCAAAACTCCAAAGGTCATCGATTTGACTGAAGAGGAGCGCATGCCGGAG
ACACTTAAAGAATACGCTCTCAAGTGCGAACAGAAAGAGAAAGATCTCTATGTCTACTAT
TTCATGAAGTAGAAAATGGGTGAATCCTGCATTATTTTCAGTAATTCAATTACTTGCACC
AAGAGAGTCAGTTCTCTCTTGACTTTCTTGAAAATCCCAAACCACTGCTTGCACTCAAAA
ATGCAACAAAGACAAAGACTTAAGAACTTAGATAGATTCAAGCAGGGTGTCCAAGCTATT
GAAAACGGCAGCAGTACTAAAAGTTCAGTTTTGGTCTGTACTGATGTAGCAGCTAGAGGA
CTTGATATCCCCTACGTGTAAAATATACTCCACTATCAATGCCCATTCAATGCTGAGATA
TACATTCACAGATGCGGTCGTACTGCTAGAATCGGTCGCTCTGGTGACTCACTCTCCCTA
TTGGCAGCTGAAGATGAGAAGAACTTCAAAATCATTAGGAAAGTGCTGAAAAAAGACGTT
GAGAGCGTTTAAATGTTCCCAGTGAGCTACTATCAACTGAATAAACTAGAGCCATTAGTA
GAAGCTGCTAAGTAATTCGAAGGTGCTCTTCATCGTAAAACTAAGGAAGAGAAGAGCACT
AGTTGGATGTTAAAATTGGCCAAATCAGCAGATCTTGACTTAGATGATGAAGACGAGAAG
ACTCTTAGAGAAATGGATGGTGAGAATTCAATTAAGTCCAAGAAAAAGAAGGGAAAGAGA
GAAGTCAAAGCACCAGTCGATATATTTGATAAGGATTTAGAGAAAATGCAGAGAAGTCTC
GATGACACTGGAGCTAGACATAAAACTAAAGCTGTCAGCAAAGTTCAATAGATGAAAGAA
AGATACGATGACTTGAAGAAACAAGAAAACTTCAAGAAAGTATCAAACAGCAGTTTCTTA
ACCCCAGAAGCCGCTTCCTACTTGAATGAAATAATCAAGAAGGGTCAGTCGCAAGTTGAC
AATGAAATCGTGTATGCTGGTATGCACAGTGATAAATCAACTCCACTCAAGTTCAAGAGA
AAGGAAAAGTTCACTAGCAGATACAAGAAGAGAACCAAGAGCAGAGGCAAAAACAGAAAA
TGA


>Contig10050.0.g108(protein)
MDSDSDSQQDNQEKQQVIQRQPTPIVPKKQAIKNWMQFDMSEELAESLVANQFVQPTDVQ
AQSLVFLNAHVDMVIAAKTGQGKTLTFGIPILDLLIKRLIKDQSGEPEEFTSIKALIMSP
TRELAIQIKDHIQAVVPVQYQNKIKLCPLVGGMSIQKQERLLSYNPTIVIATPGRLWELL
NERMNPYLQSALPMIDVLVLDEADRMIEDGHFKEMKYILDYVYSKRVEFKKLKLLREKNL
NADETDPKVLEQKKMKKDIIDRAKSQKDNMVIKTIETNKNIKFDMNKVVDLYDESEMLEE
IDPDELIVEDGHKNDEEKEEGKGKGKKQKRLSQQQLSKEQEEKFAAEYKKMGGIQHIICS
ATMTIDPTGRITPKKAKKILKSGHNKPEAVDTLEQLCKTLRFRTKTPKVIDLTEEERMPE
TLKEYALKCEQKEKDLYVYYFMKQKMGESCIIFSNSITCTKRVSSLLTFLKIPNHCLHSK
MQQRQRLKNLDRFKQGVQAIENGSSTKSSVLVCTDVAARGLDIPYVQNILHYQCPFNAEI
YIHRCGRTARIGRSGDSLSLLAAEDEKNFKIIRKVLKKDVESVQMFPVSYYQLNKLEPLV
EAAKQFEGALHRKTKEEKSTSWMLKLAKSADLDLDDEDEKTLREMDGENSIKSKKKKGKR
EVKAPVDIFDKDLEKMQRSLDDTGARHKTKAVSKVQQMKERYDDLKKQENFKKVSNSSFL
TPEAASYLNEIIKKGQSQVDNEIVYAGMHSDKSTPLKFKRKEKFTSRYKKRTKSRGKNRK