Identifiers and Description

Gene Model Identifier

Contig1211.1.g94

Standard Name

DDX21c

Aliases

Contig1211_1_g94

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001050607.996200075452222e-123DEAD/DEAH box helicase family
protein
SGDYGL078C5.997992534675281e-52DBP3 SGDID:S000003046, Chr VII
from 361859-360288, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1211.1.g94(coding)
ATGATTGAAGATACACAAAGCAACTTTTAAGTTGCCGACCTCCAAGAGACTACAACTATG
GACACCAACTTCGAAGGTAAGAGTAGTAGTTCAAGACTACAAGAGCAAGAGCACCTCACT
GGCATTGACTCTCATCTCAGAAAGTACCCAAAAGGCTCACCTATCCAGAAGATCGCTCAT
CAGCAACCAAAGGCAAGGCTTCCAGATGTTGAGAGACAAGACTACGAGTTCAAGATGAAC
ACATCTCCAGATGATGACAACCAGTACTATGATGCTTTCTAAGAAGAACCCTCAGAGATG
ATCACACCCCAAGATAACATGAAGCAGCACACACCCTCTAAGCATGTCTAGATCCCTTCA
TCTGTGAGATATCAATCAACTTCACCTAAGAAAAGTGACAAAAATCAAGATTTGGACATC
ACTACATCAACAAAAATGGCTTCTCCAGGTTCAGGGCAAAATCAAGCAAAAAGTCAAGAA
GACACTCTGGACCAAGACCAGCAAACTCACATGACCAGCACCTACGATGACTGCCAAAAC
TTCAAGATCACTGCTAGCATGAGTCCAACCAGGAAAGAGTCCAAGAGTCAGAGAAAAGTC
GAAAAGATGCTTTCCACTGCAAATGATCATCAAAATGATAATCAAGCCATCTCTGCCACA
TTGCAAGCTGTTCTTGACAATGACGTCTAAAGTTAAGAGCAAAGGCAAAGCCACTACTCT
GACGATGAAGAAGAGAGCGAGAGGATCAAGCAGGCAACCATTGAGTATGTGGAGAGGCTC
ATATGCAGAGGGGCTGACGATGACAGTCAGAGAAATGGCTCAGAAGATGGAGATGAACAG
ATGATTGTGGAACTAAACCAACCAATCCCCAAGAGAAACATCTTGCCAGAAGGCTTTGAG
AGCGACGATGATGACCAATTCGAGGAAGCTTTCAAGCGCAGAAGGGACATCAAGAAAGAG
CACAAGACCGATGAGGATGAGAGACCAAATCCAATGAATGACGATGATTGCTGTGATTTT
GATGATTTCACTCTGAAAAAAGGAAATCTAAAGAGAGATTCTATGAAAGATAAAAGCAGA
AGCCAGAGCAAAGATTCAAGAAATCACCACTCTCAGAAAGATCGCAGAATTTAGTCATCT
TTTCATCAGGAAGAGAGAGACGATTCTGAGAAAGATATGAGGAGGATGGACAACAACAGA
TCCAAGTCAAAGTATCCTTCTGAAGTTGTTTCAAACAAAAAGGATATGAGTTCAGGCAAT
GAAGTTTATGGTGACTCATAAGAGGGATAGTTTGTCAACTACCCTGAGATCAGTCAGAAG
TCTGTGGCTATCTTAAAGGAGAGAGGCATCAAGTACCTCTTCCCCATTCAACAAGAGTGC
TTCTACCCCATCTATGAAGGCAAGGATTTGATAGGCAGAGACTTAACAGGCTCAGGAAAG
ACTCTCGCTTTTGTCCTCCCACTACTTGAGAGACTTAGAAAGACTAAAAAACTTGGTACA
AGAAAGATCTAAGCTATAGTTCTTGCTCCAACCAGAGAACTAGCTGTGCAGGTACAAAAC
GTATTTGCTTAAATGAAACACTTTGATGACGAGTACAGAACCTTGACAGTGTATGGTGGA
GTCCCAATTGATCCTTAAACTTCAGCTTTGACCAGAGGTGTGGATATCTTTGTTGGTACT
ACTGGTAGAGTACTTGACCACATCGAGAGAGGTAACATCGACTTTTCAGGTATCAAGTCA
GTGTTCTTGGATGAAGCTGATGTGATGTTGAAACTTGGTTTCAAGGAAGATGTAGACAAG
ATCCTCTCTATCATTCGTGATCAATGTCGTGAGGACATCTAAATTTGCTTGTTTTCAGCA
ACTATTCCACCCTGGGTTCGTGACATCGCACAAGAGCACTTAAGATAAGGTTATACCATG
GTTGACCTTGCAAAAGATCTCAAGAACAAGACTGCCAAGAGAGTGAGACACATAGCCATC
AACTGCCCATTCTACAAGACCGAGCAAGTAATTCTCGACTTGTTGATGATGTATGGTACA
GGAGGTAGATCGATAGTATTCACTAAGACTAAGTCAGATGCAAACTCACTTATATCTTCA
GACAGATTCTCAAAGAATGATATCCAAGTCATGCATGGTGACATTCCACAACATTCAAGA
GAGATGACTCTCAGAGCTTTCAAAGAAGGTAGATTGAAGGTTCTAGTTGCTACAGACGTT
GCTTCCAGAGGTCTTGACATTCCAAATGTTGAACTTATTGTACAAACTGAACCACCACAA
GACCCAGAGACTTACATTCACAGAGCTGGTCGTACTGCAAGAGCTGGCAAGGAAGGTACA
TGCATTGTCCTCTATCAGAACAAGACTCAGTACATGATGGAGTAGATTGAGCAACGTGCA
GGCATACAGTTTGAACAAATGTCTGCACCATCCCCAAGTGAAGTCATGAATGCAAAGCAA
AAGCTAATGGATAATCAAAAGAAGAGTGGCAAGAATGGTCAGGGAGTTGTGAACAATATC
ATGGAGATTTCCCAAGTTGATGAAAACTTCAACATCAAGGATCACTTTGAAGAGGCTCAA
GAGTTACTTACTCAGTTCGAAGGAGATGCAAAGAAAGCACTTTGCAGAGCTATTGCCTTG
ATCAAGAATCTCTAGACAAAGCAACAGCCCATTGAAAGATACAATCCAGATCTCGCTGCT
AGCAAGCCTGACTATCAAAATTCAAACACCAGAGTCTTTGACAAGGAGAACAGATCAAAT
ACTTTTAACTCTTAGCCAACTGGCTTTGGCAGAGGTAGAGGAGGTTTTGCAGGTAACACC
ATGAGCAGAGATGAAGAGAGCAAGCCATTTTCAAGAGGCAGAGGATAGAGTATTGGAGGC
GCTGGTCCTGGAGTCAATCAATTCAGAGATTTCGATAATAATCGCAATCAAATGGACAGA
GACGGTGATGGCAAGTCTAGCAAGTACTCTCATATGTCGAATATGAGCAGACCTTCCCAA
TTCAACTACTCTACCCCACAAAGCTCAGTTCATTCAACCCCATCTTACAACTCTCATGAA
AGCTTTTCAGGCAGACAATTCCCAATGCAACAACAGAGAACTCCACAGGTAAGCGGTGCT
GAGTCTTACATTTCATAGACACCAGCTGACTTCAGAGACGAGGACTCTTCAAGAATCATC
TTCATGTCAAACATTCACTATAAGTGTAGTGAGAGTGATCTATTCACACTGTTCAGAGAG
AACAACCTGAGAGTTTCAAAGTTGATCATTCACAGAGACAAGGAGACTGGATAGACTAAG
GGTTCAGGGTTGTGCATGTTTGAGAGTCCAAGAGAAGCCTAGCTCGCCATTCAGAGATTG
AATGGATTTGAGTACATGGAGAGAGGCATTGTACTTAACCCTCATATGCCAAGATCCTCA
GTACCACCTCAAACATTCCCACCACAAGGTCCTCCTCCAACTCATGCTATGATGTAGAAT
TCAGGCATCTAGAGAGACAGCTATCCATCAACCAGAGGAGTCAGAAATGAAGGCTACCCT
TCAACCATGCAAGGCGGAGCACCTCCTCGTCCAGTTAACAACATGATGAGAACTGAGAGA
TTCGACTATGAAGAGAGACAACCCTACAAGAGTCAAATGCAAGGAGGTCCCATGAACATG
AACTCTGGTCCTTCAGCTCCTTACCAACCCAGAGAATTTCCACCAAGAACAGGCTATGCT
GGGCCATCAGCCAACCCAATGAACAACAACCCTATGAGATCTGCTGGTAGAGGTAACCCC
ATGCCTAGATACTGA


>Contig1211.1.g94(protein)
MIEDTQSNFQVADLQETTTMDTNFEGKSSSSRLQEQEHLTGIDSHLRKYPKGSPIQKIAH
QQPKARLPDVERQDYEFKMNTSPDDDNQYYDAFQEEPSEMITPQDNMKQHTPSKHVQIPS
SVRYQSTSPKKSDKNQDLDITTSTKMASPGSGQNQAKSQEDTLDQDQQTHMTSTYDDCQN
FKITASMSPTRKESKSQRKVEKMLSTANDHQNDNQAISATLQAVLDNDVQSQEQRQSHYS
DDEEESERIKQATIEYVERLICRGADDDSQRNGSEDGDEQMIVELNQPIPKRNILPEGFE
SDDDDQFEEAFKRRRDIKKEHKTDEDERPNPMNDDDCCDFDDFTLKKGNLKRDSMKDKSR
SQSKDSRNHHSQKDRRIQSSFHQEERDDSEKDMRRMDNNRSKSKYPSEVVSNKKDMSSGN
EVYGDSQEGQFVNYPEISQKSVAILKERGIKYLFPIQQECFYPIYEGKDLIGRDLTGSGK
TLAFVLPLLERLRKTKKLGTRKIQAIVLAPTRELAVQVQNVFAQMKHFDDEYRTLTVYGG
VPIDPQTSALTRGVDIFVGTTGRVLDHIERGNIDFSGIKSVFLDEADVMLKLGFKEDVDK
ILSIIRDQCREDIQICLFSATIPPWVRDIAQEHLRQGYTMVDLAKDLKNKTAKRVRHIAI
NCPFYKTEQVILDLLMMYGTGGRSIVFTKTKSDANSLISSDRFSKNDIQVMHGDIPQHSR
EMTLRAFKEGRLKVLVATDVASRGLDIPNVELIVQTEPPQDPETYIHRAGRTARAGKEGT
CIVLYQNKTQYMMEQIEQRAGIQFEQMSAPSPSEVMNAKQKLMDNQKKSGKNGQGVVNNI
MEISQVDENFNIKDHFEEAQELLTQFEGDAKKALCRAIALIKNLQTKQQPIERYNPDLAA
SKPDYQNSNTRVFDKENRSNTFNSQPTGFGRGRGGFAGNTMSRDEESKPFSRGRGQSIGG
AGPGVNQFRDFDNNRNQMDRDGDGKSSKYSHMSNMSRPSQFNYSTPQSSVHSTPSYNSHE
SFSGRQFPMQQQRTPQVSGAESYISQTPADFRDEDSSRIIFMSNIHYKCSESDLFTLFRE
NNLRVSKLIIHRDKETGQTKGSGLCMFESPREAQLAIQRLNGFEYMERGIVLNPHMPRSS
VPPQTFPPQGPPPTHAMMQNSGIQRDSYPSTRGVRNEGYPSTMQGGAPPRPVNNMMRTER
FDYEERQPYKSQMQGGPMNMNSGPSAPYQPREFPPRTGYAGPSANPMNNNPMRSAGRGNP
MPRY