Identifiers and Description

Gene Model Identifier

Contig21785.0.1.g109

Standard Name

DDX21b

Aliases

Contig21785_0_1_g109

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001050603.9988573992424687e-147DEAD/DEAH box helicase family
protein
SGDYOR204W2.0007467515522948e-59DED1 SGDID:S000005730, Chr XV
from 722911-724725, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21785.0.1.g109(coding)
ATGGACACCAATCAAAACGACGCTTCAAACGTAGGCGGTCACACCAGAAAACCATCATTT
TTCAATAGTAAAAAGGGACCTACTGCTGCAACTGATTAACCTTAATCAAATAATGAAACA
ATTGTATAACCAAAGGAATAAAGCAACAACATTTAATCGTCATAGCCATCATCAACTGCA
CAGAATCTATCTTAATAAAAAAATATATCAGTTAATTCGGATGTCAAGGGAATACAGGCA
ATAGCCAGACCTACAACTGGGCATCATTAGCATTCTCAGAGTGTGGGTGGCTAAATAAAT
TAAGTTTCAGCCAATGGCGGCTTTTAGGGCAATCTAGGAGGATTTTAAAAGAACATTGGA
GGAGCAGTAACTGGGAATTCTGAAGTTGTTAAAGAAGTGCATCTTAATAAGCAAAGACTT
TAAAATGAAAAATTACCCCAATACGATGTTGCGGATGGAAATTTTTAGAATTTCCCTGAG
ATACCCCAGAGGACAGTAGATAAGTTAAAGTCTCGTGGAATCATAAGTCTATTTCCAATT
TAATAACAAACTTTCTATCCAATTTACAACAGAGAAGATGTTATTGCTAGAGATTTGACA
GGTTCAGGTAAAACACTTGCTTTTGGTCTCCCTATCATTGAATATTTGAGAAAGAACAAG
TTCTTGGGATAGAGAAAAGTACAAGCTATCTTATTAGCACCAACAAGAGAATTAGCTATT
TAAGTGCAGAATGAGTTATCTCAGCTCAAGCACGGAGATATGGAATTTAAATCTATTACA
GTTTATGGTGGAGTCCCAATTGATGATCAGGCTCGTGACTTAAAATACGGTGTAGATATC
ATAGTAGGAACTGCTGGTAGAGTAAAAGATCATATCGAGAGAGGCAACATAGATTTCTCA
AGCGTAAAATCCTTCGTGTTAGATGAGGCAGATCGTATGCTTGATCTTGGATTCAAGGAT
GATATAGAATGGATTATGTCACAGATTACAAGGCAATGTCAGTTTGATGTGCAGAAATGT
TTATTCTCAGCTACAATTCCACTATGGGTTAAGAATGTGGCCAGATAGTATCTAAAACCA
AACTATAGACTCGTAGATTTAGCTTAAAACCTGACCAATAAAACTGCGAAATCTGTGTAA
CATTTATCTATATGTTGCCCTGAATAGAATAAGATGTCAACTCTAGCAGACTTGTTGATC
TGCTATGGAGGTGATGGAAGAGCTATAGTTTTTACTTAAACTAAAGTTGATGCTAATGCC
CTAATTTTGACAGATAAGATCAAGCAAGATATTGAAGTGATGCATGGGGATATCCCCTAA
AATCAAAGAGAAGTGACTTTAAAGCGCTTTAGAGATGGTAAATTCTCAGTGCTTGTAGCA
ACAGATGTAGCTTCTCGTGGCCTTGATATCCCAAACGTTGACTTAGTTATATAAGTAGAG
CCTCCCAATGAAGTGGAGACATATATCCACAGATCTGGGCGTACAGCTAGAGCAGGTAAA
ATGGGCGTTTGCATTACTTTTTATACAAAGAAGAGTCAGTATATGATTCAGTAGATTGAA
AGTCAGGCAGGAATTAAGTTTAAGAATATTGGTATTCCCTCGGCTTAAGATGTTATTAGA
GCTTCATCAAAACTTATGCTCAAGAATCTTGATCAAGTAAACGATCAAGTAATCCCTTAT
TTCACAGAAGCAGCAAAAGATTTGATTGATATGTGTGGTGGCAACCAGGAGAAAGCTCTA
TGCAAAGCCCTTGCCTATATTTCAGGCTACTATAAAACAGCCTTCTAAACAAGAAGTTTG
ATAACTGGCCAGGAAAGACAAATCACTCTTGAGCTTAAGCTAATTTAAGTCCCTGAAAGT
AAAACTGCAAAAACATGGAGAGATCCCTTAACAAATGGAGTGTAGATTTTCAAGAAGTAT
TTCCCTGAGAAAATAGTTGATCATTTAAGAGGCATGAAGGCGAAAGCTGATCGCACAGGC
ATAGTCTTTGATATAGATGAAAACTAAGCTGATAGATTTATTGAAATTGCAAGTCATTTG
GCAGAGACTGACTCTACGATTGACTTCTAAATTTTTAAGTGCTTGGCTCTACCAGAGTTA
CTAGATGAAGAGTAGTTTAGTTCATGGAAAGGAGGTGCTTCAGGTGGTCATGGCAGCGGA
TTCAAGCATAATAGACATCAAAGTTTCAATGTTAATTCAACTGGTTAATATGGTGGAGGC
TTTAAGAGTAACAACTACGGAGGAGGTGGCTTTGGAAATGACAACAGAGGTGATTATGGA
AATGATAACAGAGGCGGCTATGTAAACAGGGGAGGCAACTAAGGTGCTGGTCGTGGAGGT
TACCATTCAAGGCAGGCTTCAGGCTAAGGCAGTGGCTTTGTCAGTGGAGCAGCTGGCGGG
AATCCAAGAAGTGGCTTTAACAGCAGAAAAGGCAGCAACTTCAATACTAGCAATAGAGAC
AACGATGATTTGCATTCATATAATGATAACGATGAAGATCTCAATGACCCATATATGGAA
GATTTTGATGTCAGAATTGACCACAAAGACTCTGGAAACAACAACGGTGCGAGCTACCAT
AAAAAGCCACCTTCTAAGAAGAACTCCAACTCCAATATTGGAGGAGGAACCAGCAAATTC
CAACCTAAAAACGCAGGAAAACCCTTAGTATCACACAATTGCAACAAATTATTTATAGGC
TCTATTGACTTCAACATGACTGAGGATGACTTGACAGAGCTATTTTAGAGTTTGAATTTG
ACAGTAACGAAACTTAACTTGCTCAAGTAGGGTGATGGAAGACATAAGGGAGCTGGCTTT
GTTGAATTTGCTAGCAATGAAGAAGCAGATATTGCAGTCAGTGAACTTGATAATTACCAA
TTCGGTAGACAGAAATTGCGTCTAGAATTCACAAAATGA


>Contig21785.0.1.g109(protein)
MDTNQNDASNVGGHTRKPSFFNSKKGPTAATDQPQSNNETIVQPKEQSNNIQSSQPSSTA
QNLSQQKNISVNSDVKGIQAIARPTTGHHQHSQSVGGQINQVSANGGFQGNLGGFQKNIG
GAVTGNSEVVKEVHLNKQRLQNEKLPQYDVADGNFQNFPEIPQRTVDKLKSRGIISLFPI
QQQTFYPIYNREDVIARDLTGSGKTLAFGLPIIEYLRKNKFLGQRKVQAILLAPTRELAI
QVQNELSQLKHGDMEFKSITVYGGVPIDDQARDLKYGVDIIVGTAGRVKDHIERGNIDFS
SVKSFVLDEADRMLDLGFKDDIEWIMSQITRQCQFDVQKCLFSATIPLWVKNVARQYLKP
NYRLVDLAQNLTNKTAKSVQHLSICCPEQNKMSTLADLLICYGGDGRAIVFTQTKVDANA
LILTDKIKQDIEVMHGDIPQNQREVTLKRFRDGKFSVLVATDVASRGLDIPNVDLVIQVE
PPNEVETYIHRSGRTARAGKMGVCITFYTKKSQYMIQQIESQAGIKFKNIGIPSAQDVIR
ASSKLMLKNLDQVNDQVIPYFTEAAKDLIDMCGGNQEKALCKALAYISGYYKTAFQTRSL
ITGQERQITLELKLIQVPESKTAKTWRDPLTNGVQIFKKYFPEKIVDHLRGMKAKADRTG
IVFDIDENQADRFIEIASHLAETDSTIDFQIFKCLALPELLDEEQFSSWKGGASGGHGSG
FKHNRHQSFNVNSTGQYGGGFKSNNYGGGGFGNDNRGDYGNDNRGGYVNRGGNQGAGRGG
YHSRQASGQGSGFVSGAAGGNPRSGFNSRKGSNFNTSNRDNDDLHSYNDNDEDLNDPYME
DFDVRIDHKDSGNNNGASYHKKPPSKKNSNSNIGGGTSKFQPKNAGKPLVSHNCNKLFIG
SIDFNMTEDDLTELFQSLNLTVTKLNLLKQGDGRHKGAGFVEFASNEEADIAVSELDNYQ
FGRQKLRLEFTK