Identifiers and Description

Gene Model Identifier

Contig9705.0.g90

Standard Name

DDX21a

Aliases

Contig9705_0_g90

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam08152 ) GUCT (NUC152) domain
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam04851 ) Type III restriction enzyme, res subunit
  • ( pfam12847 ) Methyltransferase domain
  • ( pfam09701 ) CRISPR-associated protein (Cas Cmr5)
  • ( pfam07172 ) Glycine rich protein family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001050607.003368684633018e-175DEAD/DEAH box helicase family
protein
SGDYHR065C3.0011931572567413e-53RRP3 SGDID:S000001107, Chr VII
I from 229037-227532, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9705.0.g90(coding)
ATGCCAAGAGACAGAAAAAATTCAGAGGATAAATCAGCCATTGCTAAGAAGCGTACACGC
AGAGACTCTTCAGCATCTCCAAAGAGAGAATCTGATAAAAGTAATTATTCACATTCATTA
AATATATTATTATCAGAGAGCAAAAAGAGAGATGAGAAGAGAGACGATAAGAAAAGCATT
AAGAAGGAAAAGTCACCAAGCAAGAAAACCATTGCTGTGGAAAAGGAAGTTGATCATGTT
AAAACTAGAAGAATGAGTCAAGCAGCCGATCAATTAGCTAGTACAGTAGACCAAGAAGGT
CTATATGAGAATTTCCCATAGATCACTCCAAAAACTGTTGAGCTATTGAAAAAGAGAGGC
ATTTCAGGATTGTTCCCAGTACAGTATTCATCATTCAATCACATCTGGAACAGAAAGGAC
TTAATCGTTAGAGATCTAACTGGGTCAGGTAAAACTTTAGGTTTTGCTCTACCAACTGTT
GAATATCTTAGAAAGAATAAGTTATTCGGAACTAGAAAGATTTAAGCAATGGTTTTAGCT
CCCACCAGAGAGTTGGCTTTACAAGTGTCAAAGGAGTTCAATGCCTTGAAACATTTCGAG
GGTGAGTACAATGTTCTGACTGTTTATGGTGGTGTCTCAATCGATGACTAGACTTACTAG
CTAAGAAAGGGAGTAGATATTTTCGTAGGTACTACTGGTAGAGTTATGGATCATATGGAG
AGAAGAAATTTCGACTTCACAGATCTTAAAACTCTTATTCTTGATGAGACAGATCAAATG
TTAAAGCAAGGATTTAAGGAGGATGTTGAAAGAATTATGCAAACTATCAAAGCTGCAAGA
CCAAACGGTATGCAAGTACTTTTATTCTCAGCAACAATTCCTTTCTGGGTTAAGTAAGTT
GCTAAGGAACAGATGGCACCAGACTTTTAAATGGTAGATTTAGCCTAAAATTTGAAAAAT
AAGACTTCAAAGACTGTTAACCATTTATCAATCAACTGCCCATATTAAAACAGAATGTCA
GCATTAGCTGATATCCTTATTTGCTATGGAGGTCTTGGACAAACTATCGTTTTCTGCTCC
ACTAAAGCTGAAGCCAACTCTTTATTATTGTCCGATAAAATCAAGCAAGATATTGAAGTT
ATGCATGGTGATATTGCTCAAAACCAAAGAGAAGTCACTCTTAAGAGATTTAAGGAGAAC
AAGTTCAGCGTACTAGTCGCCACTGATGTCGCCTCAAGAGGTTTAGATATTCCAAACGTT
GATTTGGTTATCCAAGTTGAACCACCCAATGATGTTGAATCTTACATCCATAGAGCTGGA
AGAACAGCTAGAGCAGGTAGAACTGGTACTTGCATTACTTTCTACGGAAAGAAGCATCAA
TATATGATTAACATGATTGAATAGAAAGCTGGTATCAAGTTCCAGAAAATTGGTGTCCCA
CAACCAGAGGATGTCATCAAGGCCTCATCTAGAGATGTAATCAAGAACCTTGACTAAGTT
AACGACGAAGTACTACCATTATTCGACGATACCGCAGACGGTTTGATTTAGAAATATGGA
GGAGATGCCAAGAAAGCCTTAACTGCAACTCTTGCTTATTTATCAGGTCACTATAAAAAC
GTTCTAGGTTCAAGAAGTGTCCTAACTGGATAAGAGAACTATGTGACAATTGAAATGAAA
TTCGATAATCCATTCAACTCAGTATCATTTGTCTGGAGCATATTGAAGAGACATTTAACC
GATAGTATTGTTAACGGAATTAGAGGTATGAGAATGTTCAAAGATCTAAAGGGAGTTGTT
TTCGATGTAACTGATGATTCAATTGAGAAATTTGAAGATGTTTTTAATCATCTTGCAACT
GAAAAGAGAGTTGACTTCCACGTTGGAAGAGCAAAAGAACTACCAGAGTTAAAGGAAGAT
GCTGACTTTGCACCAGCTCAAGGTGGTTACGGAAACCAAGGAGGTTATGGTGGCCAAGGT
GGCTATGGAGGCAGAGGCGGATATGGTCAGTAATAATCTGGCTATGGAAGAAATCAACCT
CAAGGAGGCTATGGCGGTTAAAATAGATTTGATTCATACTAATAAAGAGATTAATCTCAA
GCTGCTCCTTCACGTGGAGGTCCAGGTAATGATGAAAAAACAGTCTTCGTTGGCAATCTT
GGTTTTAACACTCAAGAAAAAGAAATCAGCGAAATCTTCACTAAAGAGAGATTAAACCCA
GTCAGAGTAAGAATGCTATAGTCTGATGGAAGATTCAAGGGTGCCGCTTTCGTAGAATTC
GATAGCAAGGATGATGCTGATAAAGCTTGCAAATGTGATGGTAAGAGTTTTGGAGATAGA
AAAATCAGAGTTAACCCTGCTGGCAACAAACCAAACACCTCAAGATGA


>Contig9705.0.g90(protein)
MPRDRKNSEDKSAIAKKRTRRDSSASPKRESDKSNYSHSLNILLSESKKRDEKRDDKKSI
KKEKSPSKKTIAVEKEVDHVKTRRMSQAADQLASTVDQEGLYENFPQITPKTVELLKKRG
ISGLFPVQYSSFNHIWNRKDLIVRDLTGSGKTLGFALPTVEYLRKNKLFGTRKIQAMVLA
PTRELALQVSKEFNALKHFEGEYNVLTVYGGVSIDDQTYQLRKGVDIFVGTTGRVMDHME
RRNFDFTDLKTLILDETDQMLKQGFKEDVERIMQTIKAARPNGMQVLLFSATIPFWVKQV
AKEQMAPDFQMVDLAQNLKNKTSKTVNHLSINCPYQNRMSALADILICYGGLGQTIVFCS
TKAEANSLLLSDKIKQDIEVMHGDIAQNQREVTLKRFKENKFSVLVATDVASRGLDIPNV
DLVIQVEPPNDVESYIHRAGRTARAGRTGTCITFYGKKHQYMINMIEQKAGIKFQKIGVP
QPEDVIKASSRDVIKNLDQVNDEVLPLFDDTADGLIQKYGGDAKKALTATLAYLSGHYKN
VLGSRSVLTGQENYVTIEMKFDNPFNSVSFVWSILKRHLTDSIVNGIRGMRMFKDLKGVV
FDVTDDSIEKFEDVFNHLATEKRVDFHVGRAKELPELKEDADFAPAQGGYGNQGGYGGQG
GYGGRGGYGQQQSGYGRNQPQGGYGGQNRFDSYQQRDQSQAAPSRGGPGNDEKTVFVGNL
GFNTQEKEISEIFTKERLNPVRVRMLQSDGRFKGAAFVEFDSKDDADKACKCDGKSFGDR
KIRVNPAGNKPNTSR