Identifiers and Description

Gene Model Identifier

Contig1255.1.g18

Standard Name

DDX10

Aliases

Contig1255_1_g18

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam13959 ) Domain of unknown function (DUF4217)
  • ( pfam03033 ) Glycosyltransferase family 28 N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002191809.997093137033517e-262DEAD/DEAH box helicase family
protein
SGDYJL033W4.999183039934807e-156HCA4 SGDID:S000003570, Chr X f
rom 383837-386149, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1255.1.g18(coding)
ATGCCAGAAACAACTAAACCAGCTAAAAGTCCCAAAAATAACAAGAAGTAGGGGAACAAC
AAAAAAAGAGATAATAAAAATCAGAGAAAGAAGGGAGCGCCAAAGTGGAAAAATGTAGTG
GCTGAAATTGAAGGGTTAAAGAAAAGAATTGCTGAAGAAGTGCCACCTCCAGGTGTATTG
TATTACAAATACAAAGCAAAAGATGAGAATGAAGAGTAAAATCAAGAAGCAGCTGATGAT
TCATCTAAATTAAACACTAAGTCCTCTAGATTGATCGCAAATCGTAAAGTTCTAGAAACA
GACGACAAGACTAAGATTAAAATCAGATTTAGCGACTTGCCAATTTCAAAGGCAACAAAC
AATGGTCTTTACAAAGCTAAGTTTATTAAGATGACAGAAGTTTAGAGGGCAGCCATTTCA
CATGCCATAGCTGGAAGAGATGTAGTAGTGAGTGCTAGAACTGGTAGTGGTAAAACTCTG
AGTTATTTAGTTCCAATTGTCGAAAGACTTTATCATGAGAGATGGAGCAGCATGGATGGC
CTAGGAGCTTTAATTTTAGTGCCAGTAAGAGAGTTAGCTCTTTAAGCTTTTGAAGTTTTG
AGATCATTTGGAGCTTTTCACGATCTGAGTGCTGGACTTGCTATAGGAGGTAAAGACTTG
AATTACGAGCAAGAGAGAATCAGAGGCATGAATATTTTAATATGTACTCCTGGTAGACTT
CTTTAACACATGAATGAAAGTGAAGGCTTGGACACCAGCAACTTGAAGATGCTTGTCATC
GATGAAGTTGACAGAATTCTTGATATGGGATTTAAGGACACTATGGAGTAAATTATGAGA
AACTTACCAAAAAAAACATAAACAATGCTTTTCTCTGCAACAGTTGGTAAAATTCTTAAA
GACATGGCAAGAGTTAACTTAAAACCTGATCATGAATACATTTGTATCCACGACTATGAC
TCAATTGAAAGTTTAGCTAACGACTACAATCCTAATGCCAGTGCTGAAGATAAAATGATT
GTTGATCAACTCAAGTCTATTACACCTGTTAAACTACTTCATTTCTACATGGTAATAAAT
ATTGAAGATAAGCTCGATACACTTTTCAGTTTCTTGAAGAGTCATTAGAAGAACAAATGC
ATCGTATTCTTCTCAGCCTGTAAATAAGTTCGTTTCGCCTATGAAGCATTCAAACGTCTG
AAGCTAGGCATGATTATGTTGGAATTGCACGGAAGACAAAAGTAGACCAAGCGTACAGCT
ATTTATTATGAATTCGTTGAGAGAAAGCAAGCAGTGTTATTTTGCACTGATGTGGCATCT
AGAGGTATTGATTTCCCTGCTGTCGATTGGGTTGTACAGTATGATTGCCCGGAAGATTTG
CAAACATACATTCATAGAGTCGGTAGAACTGCCAGATATAAGTCTAAGGGTAATGCTCTA
CTATTCAGTACTCCTGCTGAAACTAAGTTCATCGATAAAATCTAATAAAGAGGAATTCAA
TTAAAGAAACTCAATGCCAATCCAAATCAAGCCCTGACAATTCAGCCAACTCTCTAAAAA
CTAAATGCAGAAAATCGTGATGTCAAGCATTTAGCTGAGAAAGCCTGTATTTCTTACATT
AAGAGTATTTATCTGATGAAGGACAAGGAGACTTTCAAATTCAATGAATTGGATTGCGAG
AAACTAGCTTACAGTTTGGGTCTTGCAAACGCCCCTCAAATCGGTTTCATTCAAAAGAAC
AACCAGAAAAATACCGCAAGAGAGAATGCTGAGGATGATGAGGCACTACTAGACATTGCT
GATGAAATCGACAGTATGAAAATTAAGCCTGGTGGTGATAAGAAATTGAGTAGATTACAG
ATTTTAAGACAGAAAATCAAGGAAAAGAAAGAAGCCAAGAAAGTAGTGTAGGACCAAGAA
CTACTGTTAAAGAGGCAAATGCTGGCTTCATTGGTTGAAGATGATGAGGATGAAGATGAA
GAGTAAGATGATGAGAGTGACAGTGAAGAAAGTGAAGATAACTAATCAGATGAAGAGTCT
GATGAAGGTGATTTCTTCACATCAAAGAAAAACCAGAGAGAGTTCGATAACAACACTGAT
GATGACGAGTAGATAATTCATGAGGAAGAAGATAACAAACTCAAAGAAGAAATCAGACTG
AACGAGCTCAAAATCAACAAGAAAAAACTCAGGAAAATCACTAAAGACGGGCCATTACAA
GGCAAAAACAAGGTGTTCTTTGGCAGTGACGGCAAACCTATTACTTCTTTGGAGTATCAC
TTGTTGCAGGATAAACAAAAGCATGAGAAGAAAGCAGTAGAAGATCAATCATAGTCTGAA
CAATCTGAGGTAGAACAATAAGACCCCTCCACCCTGAGACTCTTCTAAGAATCAGAAGTT
GATGATGACTCAGAAGCTGAGGGACGTTTCATCGGGAAAGTCAAGAACCAATTGTAGAAG
AGTGAGGCTCAAGACAAGCAACTTGCCAGACAGAAACTCACAGAGTAGAGACTTAAGAAG
AAGAGAAAGATGAAGGATAGACTGAGAGGGAAAGATGATGAAGATGGTCCAGTAGTGGCT
GTGATTGGTGGAGCTAGTGATGAAGAAGACTAGGATTAAAGCGCCGACAACAATTAAAAT
GATTAATCAGATGAAGAGGAGAGTGACTAAGAAAAGAAAGTAAAAGCCAATAAGAAAAGA
AGAAGGCTCTCTGTTCAAGACAGCTTTGAACTTAAGAAACAAGAAAATTCCAAGAAAAAG
ATAACTGTTCAAGACAGTTTTGAGCTTAAGAAACAAGAATAGAACAAGAAAAAGAACAAA
GCTTTATCAGGTATGTCGGAGGAGCAGAGAGCTCTGGCTTTGCTAGAGAGAGGTTTGGAC
TTCTGA


>Contig1255.1.g18(protein)
MPETTKPAKSPKNNKKQGNNKKRDNKNQRKKGAPKWKNVVAEIEGLKKRIAEEVPPPGVL
YYKYKAKDENEEQNQEAADDSSKLNTKSSRLIANRKVLETDDKTKIKIRFSDLPISKATN
NGLYKAKFIKMTEVQRAAISHAIAGRDVVVSARTGSGKTLSYLVPIVERLYHERWSSMDG
LGALILVPVRELALQAFEVLRSFGAFHDLSAGLAIGGKDLNYEQERIRGMNILICTPGRL
LQHMNESEGLDTSNLKMLVIDEVDRILDMGFKDTMEQIMRNLPKKTQTMLFSATVGKILK
DMARVNLKPDHEYICIHDYDSIESLANDYNPNASAEDKMIVDQLKSITPVKLLHFYMVIN
IEDKLDTLFSFLKSHQKNKCIVFFSACKQVRFAYEAFKRLKLGMIMLELHGRQKQTKRTA
IYYEFVERKQAVLFCTDVASRGIDFPAVDWVVQYDCPEDLQTYIHRVGRTARYKSKGNAL
LFSTPAETKFIDKIQQRGIQLKKLNANPNQALTIQPTLQKLNAENRDVKHLAEKACISYI
KSIYLMKDKETFKFNELDCEKLAYSLGLANAPQIGFIQKNNQKNTARENAEDDEALLDIA
DEIDSMKIKPGGDKKLSRLQILRQKIKEKKEAKKVVQDQELLLKRQMLASLVEDDEDEDE
EQDDESDSEESEDNQSDEESDEGDFFTSKKNQREFDNNTDDDEQIIHEEEDNKLKEEIRL
NELKINKKKLRKITKDGPLQGKNKVFFGSDGKPITSLEYHLLQDKQKHEKKAVEDQSQSE
QSEVEQQDPSTLRLFQESEVDDDSEAEGRFIGKVKNQLQKSEAQDKQLARQKLTEQRLKK
KRKMKDRLRGKDDEDGPVVAVIGGASDEEDQDQSADNNQNDQSDEEESDQEKKVKANKKR
RRLSVQDSFELKKQENSKKKITVQDSFELKKQEQNKKKNKALSGMSEEQRALALLERGLD
F