Identifiers and Description

Gene Model Identifier

Contig21186.0.0.g65

Standard Name

DDSB1b

Aliases

Contig21186_0_0_g65

Description

DNA double-strand break repair and V(D)J recombination protein XRCC4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (IEA) | GO:0016702
  • DNA binding (IEA) | GO:0003677
  • procollagen-proline 4-dioxygenase activity (IEA) | GO:0004656

Biological Process

Domains

  • ( pfam06632 ) DNA double-strand break repair and V(D)J recombination protein XRCC4
  • ( pfam08336 ) Prolyl 4-Hydroxylase alpha-subunit, N-terminal region

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21186.0.0.g65(coding)
ATGGAGCAAAAGAACTAAAACTCAAACAATATTTTATAAAACCAGCAATAAAAGTTAGAG
AAAGAATTCTACTTCACAAAGCTAGATTTGATGAATACAAACGACTTTGTCTACGTTTTC
GTGGAGTTCGAAGAGCATCCGACTGATTTGAAGCAAGATTTTACTGTGGGCACTTTAACC
ATTTTGAAAAGTAATTTGCAAACCACTCCTATTTTCTCTGCATAATTGCAATCAATGTCA
TGTTTTAACAAGGAAATAGAATGGAACTATGCATATTTCAAGAAAATAAGGCTTTCATTT
TACAGAAGGCTAAAAGATGTAAAATTCGCATTCAAAGACCCTCACTAATCTTATAAGAGT
GACGATATCGAATACATGCTTTAAGATGAAAAACCAAAGTTCAGAATCTACTTCAAAGTA
TAGCAGCAAGCTGATGTAGTAGCATTCGAGTGCAACACCCTCAAACCCCAAATTCAACCT
CAACCCATGCATTATTTCGCAGATAAACTAAGTGAATACTTCAAGAGGAAGAACAAAGAA
CTCGATGAAATAAAAAACGAGAGAGATAAAGAGCGAAAAGAAAAGCTTTAAGCTATGAGT
GAACTATAGAAAGTCATTAAAATCCAGGAACATAGAGAGCTGAATTTGATGCAAAAGTTT
TGCTTGATTGTTAATGAAAAGAAGGCAAAAATATCAGAGCTTAAAAGCATAGTTAAAGCT
CTATAAGAAGAGGAATCTTTAAGGAGCAAATAATCAGGCGAAAGCTAATAATCGAAAGAT
AGACCTTGA


>Contig21186.0.0.g65(protein)
MEQKNQNSNNILQNQQQKLEKEFYFTKLDLMNTNDFVYVFVEFEEHPTDLKQDFTVGTLT
ILKSNLQTTPIFSAQLQSMSCFNKEIEWNYAYFKKIRLSFYRRLKDVKFAFKDPHQSYKS
DDIEYMLQDEKPKFRIYFKVQQQADVVAFECNTLKPQIQPQPMHYFADKLSEYFKRKNKE
LDEIKNERDKERKEKLQAMSELQKVIKIQEHRELNLMQKFCLIVNEKKAKISELKSIVKA
LQEEESLRSKQSGESQQSKDRP