Identifiers and Description

Gene Model Identifier

Contig10901.0.1.g33

Standard Name

DDSB1a

Aliases

Contig10901_0_1_g33

Description

DNA double-strand break repair and V(D)J recombination protein XRCC4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam06632 ) DNA double-strand break repair and V(D)J recombination protein XRCC4
  • ( pfam07862 ) Nitrogen fixation protein of unknown function
  • ( pfam10169 ) Learning-associated protein

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10901.0.1.g33(coding)
ATGGAGTAAAAGAACTAAAACTCAAACAATATTTTATAAAGTTAACAATAAAAGTTAGAG
AAAGAATTCTACTTCACAAAGCTAGATTTGATGAATACAAACGACTTTGTCTATGTTTTC
GTGGAGTTTGAAGAGCATCCGGTTGATTTGAAGCAAGATTTTACTGTGGGCACTTTAACC
ATTTTGAAAAGTAATTTGCAAACCACTCCTATTTTCTCTGCATAATTGCAATCAATGTCA
TGCTTTAACAAGGAAATAGAATGGAACTATGCATATTTCAAAAAAATTAGGCTTTCATTT
TACAGAAGACTAAAAGATGTAAAATTTGCATTCAAAGACCCTCACTAATCTTATAAGAGT
GATGATATCGAGTACATGCTCTAAGACGAAAAACCAAAGTTCAGAATCTACTTCAAAGTA
TAGCAGCAAGCTGATGTAGTAGCATTCGAGTGCAACACCCTCAAACCCCAAATTTAACCT
CAACCCATGCATTACTTCGCAGATAAACTAAGTGAATACTTCAAGAGAAAGAACAAAGAA
CTCGATGAGATAAAAAACGAGAGAGATAAAGAGCGAAAAGAAAAGCTATAAGCTATGAGT
GAACTATAGAAAGTCATTAAAATCTAGGAACATAGAGAGCTGAATTTGATGCAAAAGTTT
TGCTTGATTGTTAATGAAAAGAAGGCAAAAATATCAGAGCTTAAAAGTATAGTTAAAGCT
CTTTAGGAAGAGGAATCTTTAAGGTAGCAAGCTTAGCTATAGCAAAACAATCATAATAGC
GATAAAAATTAGAATTCAAAGAATTTGAAAGGAGCAAATAATCAGGCGAAAGCTAATAAT
TGA


>Contig10901.0.1.g33(protein)
MEQKNQNSNNILQSQQQKLEKEFYFTKLDLMNTNDFVYVFVEFEEHPVDLKQDFTVGTLT
ILKSNLQTTPIFSAQLQSMSCFNKEIEWNYAYFKKIRLSFYRRLKDVKFAFKDPHQSYKS
DDIEYMLQDEKPKFRIYFKVQQQADVVAFECNTLKPQIQPQPMHYFADKLSEYFKRKNKE
LDEIKNERDKERKEKLQAMSELQKVIKIQEHRELNLMQKFCLIVNEKKAKISELKSIVKA
LQEEESLRQQAQLQQNNHNSDKNQNSKNLKGANNQAKANN