Identifiers and Description

Gene Model Identifier

Contig8839.0.g15

Standard Name

DCUN1D2

Aliases

Contig8839_0_g15

Description

Cullin binding

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006591309.999888128184441e-42hypothetical protein
SGDYLR128W0.000000000000008002679274403579DCN1 SGDID:S000004118, Chr XII
from 398530-398532,39862...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8839.0.g15(coding)
ATGGATAGCGACGAAGAGGAGAGAGATTTCGCAAGACAAGGCGGTTAAGCAATTGATTTA
GATGGTGACTTCGACAGTGAAGAGGAAGTAGACGATGACCAGGAGGAAGATGATGATGAT
GTTCCACAACCCCAAACGCAATAACCTCAAACTTAACCCAGACAACAACCCCTCATATGT
AAATTTGGTTGTTCTTGGAAAACATATAATTCTTTGCTAAAAATTCGGTTATAGTAATCC
TTAAGTGCTATATAAAAGAAGAAGGTGACTGATTTGTAGGGTTTCGTCAACTGCAAGACT
AATGACAAACTACTTACTGATCTTTTAAAGAAGCACAACTGGGACTTGAATATGGCAGCA
GAAGAGTATTTTATGAAAGGTTACGGCGAGAAGACAGGCTCTGGAAAGATTAACCCATAA
AATATTTAAGCATTGTTCAATAAATATAAGGATGCCTAAACTGGAAATATGGAGGGAGAG
GGAATAGCTACCTTTTATGACAACTTAGGAGTTGATGCAGCTTCAGACCCTGTGACCTTA
GTCATTAGTTATTATATGCAAGCTTAGACTATGGGTTTTTACACTCAAGAGGAGTTCATT
AACGGCATGACCAAGCTCGGCTGCGATTCTATCGAATCCCTAAGAAAAAAGATTCAAAAC
TTAAAGCAAGAACTTGCCAATCCAGCTAAATTCAAGGAAATCTACAAATTTATTTTCGAC
TTTTCAAGGGATCAAGGATTCAAGAATGTTGCCATAGACACAGCTATTGCTCTCTGGCAA
ATTCTATTAAGTGATAGGTGCAATTTCCTCAATGCCTTTATTGATTTCTTGCAGTCAGAG
AAGAAAGAAATGATTGTCATTTAGAGAGATAACTGGATGATGTTGCTTGAACTTATAGAA
TAAACTTAGGGAGATATCTAGAAATTCGTTGATGATGGAGCTTGGCCACTATTAATTGAG
CAATTTAACGAGTTTTACAATAGAAAGTATAAGCACTGA


>Contig8839.0.g15(protein)
MDSDEEERDFARQGGQAIDLDGDFDSEEEVDDDQEEDDDDVPQPQTQQPQTQPRQQPLIC
KFGCSWKTYNSLLKIRLQQSLSAIQKKKVTDLQGFVNCKTNDKLLTDLLKKHNWDLNMAA
EEYFMKGYGEKTGSGKINPQNIQALFNKYKDAQTGNMEGEGIATFYDNLGVDAASDPVTL
VISYYMQAQTMGFYTQEEFINGMTKLGCDSIESLRKKIQNLKQELANPAKFKEIYKFIFD
FSRDQGFKNVAIDTAIALWQILLSDRCNFLNAFIDFLQSEKKEMIVIQRDNWMMLLELIE
QTQGDIQKFVDDGAWPLLIEQFNEFYNRKYKH