Identifiers and Description

Gene Model Identifier

Contig15171.0.g96

Standard Name

DCR2

Aliases

Contig15171_0_g96

Description

Ribonuclease III domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002842309.995317835403734e-19Dicer-related RNase III protei
n Dcr1p, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15171.0.g96(coding)
ATGCAACAATTAAACATGAACATTTCAAAGAATTTTACTCCAGACGAGCTTGAGTTTGGC
TTTATTCTCGCTAACATGATGACAAGTGTGCCTGTTCAGGAGAAACCCCTACTAAAGGAC
ATTGAAAGAGTGAACAGATACAATCAACTCAGGGGTTTTCAGTTCTTTTTAAAGCACTCA
GGGGTGAATGAAAATCAAAACGGAAATACTGAGGTCGCACTTGACCTTATGAATGAGATA
CTGAAGCCTTACAACGAGTACTATGATAAAGATAAGTCTAAGTACAACATCCTAGAGAAG
ATAGAAATGAGAGCTGGATCTCAAAAGCCCTTACAGTAAGACTCCACTGAGGAAGAAAGC
AAAAACTCAGAAGATATGCAGGATGAGATTTTTCAGTAGTTGCTCTTCTAAGAAGATTTC
TACACTGTCGAAAAATGGATGAAAGAAAAGAAACTCACTTGTGATCCAAACAACTTAAGT
GAAGAGGAGTAGATGCTATTCAACGATGAGTATATCAGGTAATTCATCAGATAAGTGAAA
AGACTACACACATCAGACAGAACTTTTGATACAACAAGAAGAGAGTCTTTGAGCCAAAAT
ATCACCATCTTAAATCCTTAACCAAAGATTTTCCAAAAATCTTTTGAAGATTATGTATCC
TAAGATGGCAAATATTAAGTGTACTGCAAAGCAATTATTCCTGTTTTGAGGGAAAGATAC
AGATGTACATACATTGAGAATAATGGTTTCAGACCAACTTACTCTAAGCTTGATGAAGTA
TTCCTCTAGGAGCAAATGGCCTTTTGTTTAGTCACAACCATTCCAATGGGATATATCCCT
CCCGTCACAATTTGCAAGTAAAATGCTGCCAATGACTACGAATTTTTCGTTGACACCATT
ATGTTTTCTGATATAAATTCTGAGCAGAATACCATTATCAAAGATATTGAGGCAACAATA
AATCATTTAAGGAACCTTGATATCTATAAGATTGATAATACCAGTGAAGGAGTTCCATTA
GAATTTGACAAAAAGTATTTTGAAGCAACTCTTTTGATGAATGAAATGTTTCTCACTGAT
TTAATGAAAAAGTAAATTAACTTTGAATTGAGAGATTCTTTCAAGAACTACCTATTCCTT
CCATTAAATGTAAATATTCAAATGTTATATCATCTCTTATAGCTTACTGAAAGTAAATAA
GATCATCATCAGTATTCAATAGACTGGAATCAAGTCATGAACATCATTGAGTTTAGCAAA
AATTACCAAAACAATACTCTTTCTCACTACTTGAAGTAAAACGGTTTGACAGACTATACA
AAAGATGCACTTATAGTTGGAAAGGGATATCCAAACATAACCTTTGAAGTTCATGATATA
TGTGAGAACATTGATTAGACTGAGGTAAAGGACATTCTATTACAGATCAAAACTAAATTT
AAAGATGCTTATTAAGGGATTCCTGCTAAATATTTTCTCTATAACTACTAAACCAAGCTA
TAAACCATCAAGAAATTCAGAGAAGAAGCATTTGCAATGATTAATGAAGAAAACTAATCA
GAGATAAAGAATTAACCTATTATTTTCCTAAAGGAGTTTACTCATCTTGAAATGTTCAAG
TTCTCTTATAAACTTTCTAATGTACCATAGAATCCAAATATAGTATGCTCTCTAAAGAAT
CATGAGTAAAAGATTCTTTTGAATAAGAGACTTCCCACTATTCATCATAGTATGGCTGTA
ACTTTCCACTACCTGGATAAGTCCTCATGGTATAGAGCTTGTCAAATGCCCTAAGTGCTA
AACTATATTGAGAGAATTGGCTTACTAAAAGACTTAAAAGAGAACATCTTCAAAGGTTAC
CCATTCAATGAAGAGTACATGCTCTGGGCCACTACTGCACCAGGTTTGTATGTAGCCAGA
AGAAACTACGAAGTCTTGGAGACCTATGGAGACACCATTCTTAAACTTGCTGCAACCATG
TTAGCTTACTATCAAAAAAGGAATGACAAGAAGGCAGGAGAAGGAGAAATAGAGAACTCA
AAGGTCTGCTTTGTAACAAACTTTCATATCTTCAGAGTTGGGAACAATTTAATGTTGCAA
AAATACATGAAAACAAAGAGAGATAGTGAGTATAAGCAATGGGTTCCTCCTATGTCTACT
GATAAAGATCAATAGTTTGTTCCTAATTAATGTGTTGGAAAAAATGTGGCTGATTGTGTA
GAATCCCTCATCTGCGCTCTTTACCTCTCTAGTAATTGCCTTCACACTGTTTTGAGGTGG
ATTTCTGAAATTAAATTGGTACCTTTAGATAAATCAACCATGCTAGATTACATTGAAAAA
GGAACGGACTGTACATTTAGACTCTATAGCCCACTTCATGATTACAAACTCCAAATTCAA
GATTAATCTAAAGATCTTTTTAACAAGTTTTTCATGGTTGAGAAAGAGAATGTTCCATCA
AACTTCAAGGATATGCTATAGCTTAGATTTGAGACACTTGAAGTGGATGAGCTGGGTTCA
GCCTATGATCTTTGCAGATACCTAAAAGGAGAATATCTAATCAAGAAAGCTTTAGTTTTA
CTTGAAGACTTGCAAGAAAATGTACTGAATTACAAATTCAAGAATCCATTACTTCTTATC
GAAGCTTTGACTCACAAATCAGCCAAAGATTAATTAGAAATAAACTTGTGCTATGAGAAA
CTTGAAGTTCTTGGGGATTCTATTTTAGATTATCTTTGCAACTACAGTTTGATATACTAT
ACCATGTTTGAGAGATACATTGAAAAAGATCCCGTGCAATATCAAATAGAGGAACATTTC
ACCCCTTCTGACGCTCATCAATCAAAATCCTTGCTTGTAAAAAATGAGCTCTTAGCAAAG
ATCACAGTGCTTTTAGGCATCCACAAGTATATCTTCTATTAAGATACCCTAGGCCTATTT
GATAAGAAAGAAGTTTCAGATTACCTTAAATATTCCTTCAGACCTAACTTTAGACTCAAT
CAGAGAGAAGTGGAACTATTCGAATGTCCAAAGCTTTTGGGAGATGTCTTTGAAAGTCTT
ATGGGAGCGATATTTATAGATGGAGGCATGAATGCAGTCATATAAGTATTTAGGAACTTA
GTGGGGCCGTTTGTACTCTTTATCGCTTAATTTTCAAAGAAATTGTATAAAGAACCAAAA
GAAGAGTTCTTGCTCACTTCTCACAGTTTCAAGATTAAGCCTCAGTACAAGTTTTATGAG
GTACCTGTCGTCATATAAGTGGATGAGTAGACTCAAGCAGAGATGATAAAAGCTGAGGTC
ATATTTAATAATGGAGAAGTCATGTGTACAGCTTATGGAAGCAACAAGAAATAAGCTGAG
AGAAATGCTAGTGTTGAGGGATTGAACTTCATTGATAGGACTTATAAAGGATTGATAATA
TGA


>Contig15171.0.g96(protein)
MQQLNMNISKNFTPDELEFGFILANMMTSVPVQEKPLLKDIERVNRYNQLRGFQFFLKHS
GVNENQNGNTEVALDLMNEILKPYNEYYDKDKSKYNILEKIEMRAGSQKPLQQDSTEEES
KNSEDMQDEIFQQLLFQEDFYTVEKWMKEKKLTCDPNNLSEEEQMLFNDEYIRQFIRQVK
RLHTSDRTFDTTRRESLSQNITILNPQPKIFQKSFEDYVSQDGKYQVYCKAIIPVLRERY
RCTYIENNGFRPTYSKLDEVFLQEQMAFCLVTTIPMGYIPPVTICKQNAANDYEFFVDTI
MFSDINSEQNTIIKDIEATINHLRNLDIYKIDNTSEGVPLEFDKKYFEATLLMNEMFLTD
LMKKQINFELRDSFKNYLFLPLNVNIQMLYHLLQLTESKQDHHQYSIDWNQVMNIIEFSK
NYQNNTLSHYLKQNGLTDYTKDALIVGKGYPNITFEVHDICENIDQTEVKDILLQIKTKF
KDAYQGIPAKYFLYNYQTKLQTIKKFREEAFAMINEENQSEIKNQPIIFLKEFTHLEMFK
FSYKLSNVPQNPNIVCSLKNHEQKILLNKRLPTIHHSMAVTFHYLDKSSWYRACQMPQVL
NYIERIGLLKDLKENIFKGYPFNEEYMLWATTAPGLYVARRNYEVLETYGDTILKLAATM
LAYYQKRNDKKAGEGEIENSKVCFVTNFHIFRVGNNLMLQKYMKTKRDSEYKQWVPPMST
DKDQQFVPNQCVGKNVADCVESLICALYLSSNCLHTVLRWISEIKLVPLDKSTMLDYIEK
GTDCTFRLYSPLHDYKLQIQDQSKDLFNKFFMVEKENVPSNFKDMLQLRFETLEVDELGS
AYDLCRYLKGEYLIKKALVLLEDLQENVLNYKFKNPLLLIEALTHKSAKDQLEINLCYEK
LEVLGDSILDYLCNYSLIYYTMFERYIEKDPVQYQIEEHFTPSDAHQSKSLLVKNELLAK
ITVLLGIHKYIFYQDTLGLFDKKEVSDYLKYSFRPNFRLNQREVELFECPKLLGDVFESL
MGAIFIDGGMNAVIQVFRNLVGPFVLFIAQFSKKLYKEPKEEFLLTSHSFKIKPQYKFYE
VPVVIQVDEQTQAEMIKAEVIFNNGEVMCTAYGSNKKQAERNASVEGLNFIDRTYKGLII