Identifiers and Description

Gene Model Identifier

Contig119.0.g64

Standard Name

DCR1

Aliases

Contig119_0_g64

Description

Ribonuclease III domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002842301.9991095569230066e-20Dicer-related RNase III protei
n Dcr1p, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig119.0.g64(coding)
ATGATGTAAAATAAGCAAGATTCTACGAATCAGCAGCAGCAACAAAATTTACAGAGTTTA
CAGGATTACTAAATGATGCAAAACTCAATCGCCCAGAGTTAAGATACCCCAAGTATCTCG
ACTACATTCACGGTGGATGACTTGAAAAAGTCAATGCGATGGATTAACAATTTGCATGGC
ATTCCAGTGGTTGAGCAATCTTTGCCTACTGAAGACCAGAAACTAGAGAAATATCTTAGT
TTAAGAGACTTAAAGGAATTCTTAGTCAGTGCATAGAGAGTTGAAGATCAAAATACTCTA
AGAAACAGATCTATCTTGGGTAGAATATCTCAGTTAATCAACTAGGAAAGCGATCAACAG
CAACCTCTGGAGTACAGTTCAGATGAAGACTTCATCCAAGTTGACACTCAAAACTACTCG
CAAAGCCACAAACTCATGCCAGATTCTATGTTCATGTCTGCTTTCAATCAGGTTAGCAGC
TCTATTGACTTTTTCCAGCAACCTTAACTCTCAATCTTTGATTAGTAAGCTGATGTGAAC
GGATCTTAGTTGTTGCAGCACCTCGATTAAATGGATGCAACTCTTTCAGACTAGGATTAA
GTAAAGCTGCACATTGAACATCTCAAGGAGCTATTCAATCGTGAGAGAGGGAAAGCCTCT
GAGAAAAAGAACAATCTTGGAAACATTCTCAGCACTTAAGTTGAAACCCCAATCATTTTA
CAGCAAGGGCTTCTTGGCAACACAAAAGAAGACTCTTAAAAGATAAATAGAATGACTGAC
ATAATCTACGGCAATGTCAAAGCTCTTATTCCACTGTGCAGAGAAAAACTCAAATTAGAG
TAGATTTCCAATGAATACTCTTCCGAAACAAAGACCAGATACAAAAGAGGGGCTTAGGTG
GCTGGCAAAGAGAAGAGAATCTTTGGTATCTTGACCCCTTATCAAGTTGGCTACATACCA
GGAGTGGATATTTGCTTCACTGAGGACGATGAAACTTTCGTGAGAGACAGCTATGTCTTC
AAGACCATGGTCTCTAAAAATCTTCAAGATATACAAAACTTGACTAAGGAATTGATAAAG
TCAAATCCAGTATAGTATAGAGAGACAGCTTCTTTGAACATTGAGAAAGAGTTATTTAAA
CTCAATGTATATGGGGACTATTCAAAGCAAGCACTTGAGGATGAAAGCAAAGATTAATTT
GTGAGAGTCGGCACATTTAATCAAATTGAAACATTCCACAAATATCTCATGAACGATTTA
TTCAAAGAAGAGAAAACAATAGAATTTTAAAAAGTCTTCTTAAAAGGCAGAGAGACCGAC
AAAAAGTACTATTTTATCCCACTAAGAAAAGTACCATCCCACAACCCTAATAACTTAGAG
TATGAAATAGATTCCAAGATGCTCTTAAAAGTTGAGAAAATCAGCCAAATTGGCTATAGA
TAGTGCTAATTGCCAATTATTAAACACCTTGAAGAGAAAAAGCAGCTCAATGATTCAAAG
TCAAAGATTGACTATCTAAGAAAGCATATTCTTGTCAAGGAAGATAAGCCTCACAGATGC
TACAACTTTTTTGAATTGCTAGATGATTTACATAATATGACTGCGTAAGATTTCGCTTTA
GCTATTAAAGGAAAACCAGAAAATCTCAATTGCAAAACTGCTTATGAGTTGCTTTTCAAA
GTATCTTCAAGATTTCAATCAGTCAACTCATTTAGAGAATGTGTTTTCCAAGGTAAAATG
GGAGACAAGGAAAAAATTGAACAATCTCCAATTATGCTGCTTGACCCCACTAAAATCGTT
ACTCATTTGAAATTTAAGTACGCTTTGGAATAATGCCCTAAGAATCTAGTTAGTGCAAAG
ATGTAGTATAAAAAGAAATACAAAGAGAAGAATAACTTGACCACATCACAAGGGAAGCCT
ATATTTTCAGCATACAATATTTACAAACACTATTTGAATCTCCAACAATGGAAACGTGGT
TGCTAATTACCTATAGTTATGCAATTCTTTGAGAGAGCAACATTTTGTCATTAACTCTAA
GCTGAGCTTGGATAAGAGATTCATCCTGAGTTTGTTTTATGGGCAACAAGTGCTCCAGGG
AACACCTCTTCAAAGAAGTGCTATGAGACTTTGGAAACATACGGAGACACTATTCTTAAA
CTAGGGGCTTGCATGCTCTCCTATTACTAATTCTATGATGACCCTAACTCTGATGAATCC
AAAATAGACCAGATGAAAAACTGGTTCATTACTAACCTTTACTTTCTTAGAGTGGGAAAG
CGTTTAGGTCTGCAAAAATATATTAGAAATGTTGATCCAGACCACAAAACTTGGAATCCA
CCTTTTAGTGAATAAGTGCAAGGAAGAGAGAATCTCACTTGTACCGGCAAGAATATTGCT
GATTGCGTTGAAAGTCTACTTGGTGCACATTTTATGACTCATAATGTTAGGAGGACTCTA
GAATTAATCTCAAATATGAAAATTATGCCTTTAAAACAAGCTGGGATTCTAGATTTCTTC
CCTGATAAGGATTTAACCTTTGTTCTTTGTGAAGACTTAGACGAGTACTAATTCATTCTG
GAGACAGATAGAGTTGCTGATATTTATTAAAAATACTTCAAAGTTCATAACTTAGATCAA
GAAATTTAAGATAGAATTAGAAGTGTGATTTGTGATAGCCCAGATAGAGGAATGAGGGGT
TAGGGTGCTGCGTTCTAAGAAGTTATGAATGACCCCGAAATTAACTTTAGAGAAATGGAG
CCTAGTGAAATCGAAAAACTATTAATTCCCTATCTATTACCAGTTGAAAAAATTCTGAAT
TATGAATTCAAAAATAAGAGATTCCTGCTTGAAGCATTTACACATAGATCCTTCAGAGAT
GCCTATGGCCTATCCTTTTGCTATGAGAAATTAGAGGTTTTGGGAGATTCAATATTGGAT
TACCTTGCAAATAGTAATTTGATTAAGTTTACTATCCTTGAAAAGTACAATATCAAAGAA
CGAATGGCACAATAGTACATTACTACAGAGGATTTTCAACCATTTGATGCCCATCAAGCC
AAATCTCTTCTCACTAAAAATGACTTCCTTGCTAAATTGGTTTGCTTATTTGGACTTCAA
GAGTATATATTGTTCTACAAACCAAGGCAAATGACACCTTAAGAGTTAAAAGATCAAGTA
ATCAAGGAAAGTACTGATGGTAAATTCGAAATGTGGAAGTATCAAAAGAAGTTGAAAGAG
TTACAAAACGAGAAAGATGCCAATAAATATCTGTAATATTCATTCAAGAAGAACTTCCTA
ATTAACGGAAAAGAATTGGAATTATACGAAGCTCCAAAGCTACTGGGTGATATCTTCGAA
TCGCTAATTGGTGCTATTTTCCGTGACGGAGGCATTGAGAGTGTAATTGAGGTGTATCAG
CACTTGCTTTCACCATTTATTGTGTTCGTGGCCAAATTTAGCAAGAAATTGTTCAAGGAA
CCCAAAGAGGATTTTATGATCCTAGCAAATTTATTGAAGATAAAGCCAGACATGAAATCA
AAGGAGCTCCAAGTAACAAACATGAAGGATTATGTCACTCACACCAACATTCTCCAAAAC
CCCTATCAAAAGCACCCTAACTCTTCAATAATTAATGATGCCAATGACTCATAGATGTAA
GATGTGAATATCGATTAGTAGTAGCAGCAAGAGCAATAATAAATGCAAATGGAATAGGAT
GATATTGGGAAAAGCACTAAAATCGCCTAGAGATTGATTTAAATCGACATTATTTTCAAT
AATAACGAAGTGATGACTAGTGGGTATGGAAACACCAGGAAGCAAGCTGAGAGAAATGCC
TCTATAAATGGGTATAACTGGCTACTTGAGAATGTTGTCGCTAAGCAATTTGCTATGTAG
TAGAGTGGAGAAAACGATGGAGGATTTGGCTTGGGACTTATGTCCTCCTATATAAATTTG
AATTAAATGTCAAGCAATGTGCTATAGTAGCATCTCTAAAATGCTCAAGCTTAAGTCCTA
GTCAGTCAAAATATGATCAACTAATCAAACCTAAACACTACCGACAACATTTCTTAGATA
AATGAGAGTAATTAATGGTAAAGAATGCAGTAACAGTAAAACATATCTTTGAATGCTAGT
GGTTTCATTGCAAATAGTGCTGCTGATGAGCTACTTTAAACTCTCTCTACCACTAAGAAA
AGAGGTGGTTAAAGTGTGACAAAACCCTAAAAGCAGTCACTTGGTAATTATCTATTTTAA
GAAGATAGTGATAGTATGCAATTTGATTGA


>Contig119.0.g64(protein)
MMQNKQDSTNQQQQQNLQSLQDYQMMQNSIAQSQDTPSISTTFTVDDLKKSMRWINNLHG
IPVVEQSLPTEDQKLEKYLSLRDLKEFLVSAQRVEDQNTLRNRSILGRISQLINQESDQQ
QPLEYSSDEDFIQVDTQNYSQSHKLMPDSMFMSAFNQVSSSIDFFQQPQLSIFDQQADVN
GSQLLQHLDQMDATLSDQDQVKLHIEHLKELFNRERGKASEKKNNLGNILSTQVETPIIL
QQGLLGNTKEDSQKINRMTDIIYGNVKALIPLCREKLKLEQISNEYSSETKTRYKRGAQV
AGKEKRIFGILTPYQVGYIPGVDICFTEDDETFVRDSYVFKTMVSKNLQDIQNLTKELIK
SNPVQYRETASLNIEKELFKLNVYGDYSKQALEDESKDQFVRVGTFNQIETFHKYLMNDL
FKEEKTIEFQKVFLKGRETDKKYYFIPLRKVPSHNPNNLEYEIDSKMLLKVEKISQIGYR
QCQLPIIKHLEEKKQLNDSKSKIDYLRKHILVKEDKPHRCYNFFELLDDLHNMTAQDFAL
AIKGKPENLNCKTAYELLFKVSSRFQSVNSFRECVFQGKMGDKEKIEQSPIMLLDPTKIV
THLKFKYALEQCPKNLVSAKMQYKKKYKEKNNLTTSQGKPIFSAYNIYKHYLNLQQWKRG
CQLPIVMQFFERATFCHQLQAELGQEIHPEFVLWATSAPGNTSSKKCYETLETYGDTILK
LGACMLSYYQFYDDPNSDESKIDQMKNWFITNLYFLRVGKRLGLQKYIRNVDPDHKTWNP
PFSEQVQGRENLTCTGKNIADCVESLLGAHFMTHNVRRTLELISNMKIMPLKQAGILDFF
PDKDLTFVLCEDLDEYQFILETDRVADIYQKYFKVHNLDQEIQDRIRSVICDSPDRGMRG
QGAAFQEVMNDPEINFREMEPSEIEKLLIPYLLPVEKILNYEFKNKRFLLEAFTHRSFRD
AYGLSFCYEKLEVLGDSILDYLANSNLIKFTILEKYNIKERMAQQYITTEDFQPFDAHQA
KSLLTKNDFLAKLVCLFGLQEYILFYKPRQMTPQELKDQVIKESTDGKFEMWKYQKKLKE
LQNEKDANKYLQYSFKKNFLINGKELELYEAPKLLGDIFESLIGAIFRDGGIESVIEVYQ
HLLSPFIVFVAKFSKKLFKEPKEDFMILANLLKIKPDMKSKELQVTNMKDYVTHTNILQN
PYQKHPNSSIINDANDSQMQDVNIDQQQQQEQQQMQMEQDDIGKSTKIAQRLIQIDIIFN
NNEVMTSGYGNTRKQAERNASINGYNWLLENVVAKQFAMQQSGENDGGFGLGLMSSYINL
NQMSSNVLQQHLQNAQAQVLVSQNMINQSNLNTTDNISQINESNQWQRMQQQQNISLNAS
GFIANSAADELLQTLSTTKKRGGQSVTKPQKQSLGNYLFQEDSDSMQFD