Identifiers and Description

Gene Model Identifier

Contig18514.0.g29

Standard Name

DCPSb

Aliases

Contig18514_0_g29

Description

Scavenger mRNA decapping enzyme C-term binding

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • deadenylation-dependent decapping of nuclear-transcribed mRNA (IEA) | GO:0000290

Domains

  • ( pfam11969 ) Scavenger mRNA decapping enzyme C-term binding
  • ( pfam05652 ) Scavenger mRNA decapping enzyme (DcpS) N-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR270W5.0000961330688895e-23DCS1 SGDID:S000004260, Chr XII
from 681186-682238, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18514.0.g29(coding)
ATGGAGCAAAAACAGCTTTAGTAGAACATACCGCCATCACTCAAAGATTTCGTCTTTGAG
AAAGTCCTCTCTAATGATGTCACTAATAAGTAAATCTACCTACTTGGTCACATGAAAAAT
GGGCTAGACATTAATGATAAAGCGCTTTTGAAATTAGAGAAATTAGCTTTTGAGGAGAAA
GATCTACAAAAACTTGGAAGAAAAGTTCATTCAACTCCAGCTTGTGATGGTAATGAAGAA
ATTAAAGATAGGGAGAGTTAAGAATTGATTGAAAAAGATGAGCATTATTTCCAGAACGAT
ATCTATAACAAGATGTTCATATGGATGAATAAAGATATTTCCAAGATTTAATGTGATTTT
GCATATCCTGCCCCTCAATCTTAAATTGATAAATACACTGCTTAAGAGTCATTCATTATT
CATGAAACCTCTGAAATGTACTTTAAGTATGTGAAACCTCTCTATATAGAGAAGTTAGAA
CCGATCCAATGGATTGAAAATGTCTTAGATGGTGTCAGTGAGATGGAACTCTAGCTATAT
AGAAGCAAAGATTTTACTGTTAAAATTGACTGGAAAATGAACTCAGAGGACTTGGAGACT
TTGCATTTGCTAGTGTTCCCATATGATCGTAAACTCAAAACTATAAGAGATTTGACTTAA
GAACATCTGCCACTTTTAGAAGAAATGTTAAGCTTAACTAATAGACTGATTAGTGAAACT
TACAAACTGCCACTATCACAAATCCGAGCATTCTTTCACTATCATCCAACATTCTACAAT
CTGCATATTCATTTTACACACGTTAGTTAACTTGAAAAGGTAGGTGCATTCTTGGGTAGA
GGGCATTCACTTGAGGATGTTATTGACAACATTAAAATGAAGGGAGATTACTACCAGACT
AAGACTATTATGGTAAGTTTAGGAGAGAATAATGGAGTTTATAGAGTACTTAAGGAAAAT
GGATAAATTTGA


>Contig18514.0.g29(protein)
MEQKQLQQNIPPSLKDFVFEKVLSNDVTNKQIYLLGHMKNGLDINDKALLKLEKLAFEEK
DLQKLGRKVHSTPACDGNEEIKDRESQELIEKDEHYFQNDIYNKMFIWMNKDISKIQCDF
AYPAPQSQIDKYTAQESFIIHETSEMYFKYVKPLYIEKLEPIQWIENVLDGVSEMELQLY
RSKDFTVKIDWKMNSEDLETLHLLVFPYDRKLKTIRDLTQEHLPLLEEMLSLTNRLISET
YKLPLSQIRAFFHYHPTFYNLHIHFTHVSQLEKVGAFLGRGHSLEDVIDNIKMKGDYYQT
KTIMVSLGENNGVYRVLKENGQI