Identifiers and Description

Gene Model Identifier

Contig2721.0.g83

Standard Name

DCPSa

Aliases

Contig2721_0_g83

Description

Scavenger mRNA decapping enzyme C-term binding

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • deadenylation-dependent decapping of nuclear-transcribed mRNA (IEA) | GO:0000290

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR173W3.0000451088882257e-25DCS2 SGDID:S000005699, Chr XV
from 657264-658325, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2721.0.g83(coding)
ATGCAAGAGTTTAAGTTTATTTATTTACTTGGACACTTAAAAGATAATGATCCAGATGTA
AAGGGAATACTGAAACTTGATAAAATGTCTTTTAATGAGTCAATTATAGCACAACTCGGA
TAAGATGATAGCAACCTCATTCTTGATGAAAATCATTATTTTTAGAATGACATTTATAGC
AAATTTATGCTTAATATGACTCCAGAAATTTCCAAGATATAGTGTGATTTCATATACCCA
GCTCCTCAATCACAGATTGATAAATACACTGCTTAAGTATATCATATTATTCTTGAGACT
CCAGAGATGCATTTTAAGTTTGTCAAACCTCTCTATATCGAAAAACTAGAGAAGCCTCAA
TGGCTCTATAATGTATTGGATGGTGTGAAAGAAGTTGAGCTAATGAAATTCAAGAACGAG
CATTTCTTACTTCAGCAAGATTACAAAGTAAATAGCAATGAAATTCAAACACTCCACTTG
TTAGCTATACCATATGATCGAACAATAACTTCAATTCGAGACCTAAATGAAACTCATTTA
GATATGCTGAAATCAATCAGAGATGATTCATACAGAACTATTAAGGAAGTTTATGGGTTA
GATAAGTCATAGATTAGAGCTTTATTTCATTACTACCCTACTTTTTATCATTTGCATGTG
CACTTCGTTCATGCAAGCTAGATTGAAAAGTGTGGTGCTTTCTTGGGTAAAGGACAACTC
TTAGAAGATGTTATTGATAATATTGAAATTAAGGGAGACTATTATCAAACTAAGACTATA
TAAGCATAAGTCGGCGAGAGTCATTAGATTTACAAAATTTTAATAATGGGCGGTTAAGTT
TGA


>Contig2721.0.g83(protein)
MQEFKFIYLLGHLKDNDPDVKGILKLDKMSFNESIIAQLGQDDSNLILDENHYFQNDIYS
KFMLNMTPEISKIQCDFIYPAPQSQIDKYTAQVYHIILETPEMHFKFVKPLYIEKLEKPQ
WLYNVLDGVKEVELMKFKNEHFLLQQDYKVNSNEIQTLHLLAIPYDRTITSIRDLNETHL
DMLKSIRDDSYRTIKEVYGLDKSQIRALFHYYPTFYHLHVHFVHASQIEKCGAFLGKGQL
LEDVIDNIEIKGDYYQTKTIQAQVGESHQIYKILIMGGQV