Identifiers and Description

Gene Model Identifier

Contig2671.0.g32

Standard Name

DCP2

Aliases

Contig2671_0_g32

Description

Dcp2, box A domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL118C1.9994498063102785e-22DCP2 SGDID:S000005062, Chr XIV
from 405564-402652, Geno...
T. thermophilaTTHERM_008256800.000000000003001226732525078hydrolase, NUDIX family protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2671.0.g32(coding)
ATGGCATCACAATAGCACTAGTTATAGCACTACAACTCATAAAATCTGACTTCCTAAGAT
TCAAGGAAGCTACAACCAATAAACACAAATCCAGATTAAATTCCCACTCATATCTTGGAT
GACCTTCTTTGCAGATTTATAATAAACTTGCCTGAAGATGAAAAGTAGGCGCCAAGAATA
TTTTGCAATTTGAAAATTGCATGCTGGTTTTTTGCAGATTTCCATTGCTCGATAGCACCT
GTAATAGACAGAAAATATGAAATGAGATTCGCATAGAGAATATGTTAAAGATGGTCTGGG
CTAAGCCACGTACTATAGAATTTTGAGAGCAAATTTGAGGAGTATAAGTAATACCTGTAA
ATGATACCATCTTTCGGTGCTCTAATGTTTTCAAAGAAATTTGAAAAACTTCTCTTCATT
GTGTATCAAAACGAGAGAGATAAAAATGTGAACAAACTTGACTTTCCAAAAGGTAAAGCA
GACGAAGGAGAATCAGATGTAGAATGCGCAATTCGTGAGATCAATGAAGAAATTCAATTC
AATATCAGACCATATATAGAAGAAGACTAGTTTATCAAGATTGAGACAATTAAGAATAAG
TTTGTCACCTTATATCTCGTAAAGGACATAGACACTAAAAATTACAACGTGAAAAGAGTG
AGATCAGCTGAAGTTCAAAAAGTAGAATGGATTGACACTAAGTTTTATCTCGAGCAAACC
TTATTGAGCGGAGTAGAAGAGCAATAAATGTATAATTGGTAATTGGTGCAGCCTTTCGCA
TACTATGTGGCTCATTTTATATCAACTTAACAGCAAATTACAGATATTGGTACTCATATA
AAGTATTAAAAGATTCTGCCTTATGAATTGGACTAAGATTAAAAGTACCAAAGTGTATAA
AGAATCCTGAATAAGTTCAACGATCAAAAGAAGTTCTATGAGTTTAAATATTAGTGGAGA
GATTAAAAATACTTCCTCGTAGCGTTGTATTATCATATGATCTAGCATAACTATAAAAAA
GCAAAGTAGCTCTATAAATAAGCCATAAGAAGATCAGAGTGCCCTAAAGGTGCCTTCAAT
ATGCTTGTGAGTTTGCTTATCTCTCAATATTCTGAACCTTAAATTTTGAGGAAGAAAATT
GATAAATTGGCTGATAAAGTCGCAATATATTTATCCCACGATTACGAATTTCTGACAACT
ATGGACCGAGTTTAAACTTACATAAATTACTTGAATTTTAACAGACCTTTGAACTAAAAT
ACAAAGAAAAATCAAAATGAAGAGTACAAGTAGCAAATGATGATACTAAGTTTAAAAAAT
ATTCATCAAAAGATCAGAAATTAGGATGATGATTTTGAGAAGATCATGACCTTGGTTTAG
GTGGGTTAGTATCTAAAGTTTGATCCTTTCATCTTGAACATGAAAATCGCCTTTGAGAGA
GGAGACAAGAAAGGCTATTAAGGTGGAATCCAAAAATTCAGATATTACTCTAACACTCAG
TAAAAGCAAGGCTACTTCAATGACATGATGATCATTGAATGCGCATCTGAGCAAGAAGTT
CATAGACTTAAGGACTATACCATGAATAATCAGGCTTTTATCTGCTGCAAGTTTGACATC
CTTTTGGATGGCTAACCATTCTCTAACATCCCTTATGAATTGAATCAGTCAGTTGATGCA
AGCTAGTATCAAATAAAAACTCAAAAGGGATAGTAGCCAATTCAAAATGAGAGATAAAAG
AATGCCGCCATTTTCTTGCTTACTTTCAAGAATATCTTTGAAAGAATTCAGGAAAGAGTA
GCATTTGAAAAACTCAAACCAGAGATATAGTAAATTGAGGAAAAAGTACAATTTGAGGAA
GAAAAAGAGACAATTTAAACTATAATTCCAGAGGTTGAAGAGAAGAAAGTCGAGAGTGTA
GTTTAATAAGTGGAGGAGCAAAAAGAAGAGCCCAGAAATCTTAAGGGCTTCCAACCATTG
TAATTCACATTAGGACTTGATCCAGAAGCTTTTGCTAATTCTATATTATAATCGTTGTAG
AAGCAATTTGACCCGAAAGCATTCACTTAAATCAATTATAAGGCTCCTCATACATGA


>Contig2671.0.g32(protein)
MASQQHQLQHYNSQNLTSQDSRKLQPINTNPDQIPTHILDDLLCRFIINLPEDEKQAPRI
FCNLKIACWFFADFHCSIAPVIDRKYEMRFAQRICQRWSGLSHVLQNFESKFEEYKQYLQ
MIPSFGALMFSKKFEKLLFIVYQNERDKNVNKLDFPKGKADEGESDVECAIREINEEIQF
NIRPYIEEDQFIKIETIKNKFVTLYLVKDIDTKNYNVKRVRSAEVQKVEWIDTKFYLEQT
LLSGVEEQQMYNWQLVQPFAYYVAHFISTQQQITDIGTHIKYQKILPYELDQDQKYQSVQ
RILNKFNDQKKFYEFKYQWRDQKYFLVALYYHMIQHNYKKAKQLYKQAIRRSECPKGAFN
MLVSLLISQYSEPQILRKKIDKLADKVAIYLSHDYEFLTTMDRVQTYINYLNFNRPLNQN
TKKNQNEEYKQQMMILSLKNIHQKIRNQDDDFEKIMTLVQVGQYLKFDPFILNMKIAFER
GDKKGYQGGIQKFRYYSNTQQKQGYFNDMMIIECASEQEVHRLKDYTMNNQAFICCKFDI
LLDGQPFSNIPYELNQSVDASQYQIKTQKGQQPIQNERQKNAAIFLLTFKNIFERIQERV
AFEKLKPEIQQIEEKVQFEEEKETIQTIIPEVEEKKVESVVQQVEEQKEEPRNLKGFQPL
QFTLGLDPEAFANSILQSLQKQFDPKAFTQINYKAPHT