Identifiers and Description

Gene Model Identifier

Contig6308.0.g39

Standard Name

DBR1

Aliases

Contig6308_0_g39

Description

Calcineurin-like phosphoesterase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00149 ) Calcineurin-like phosphoesterase
  • ( pfam05011 ) Lariat debranching enzyme, C-terminal domain
  • ( pfam12850 ) Calcineurin-like phosphoesterase superfamily domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000669507.997481627602355e-72Pyridine nucleotide-disulphide
oxidoreductase...
SGDYKL149C9.999353957415832e-59DBR1 SGDID:S000001632, Chr XI
from 168829-167612, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6308.0.g39(coding)
ATGAACGTAGCTGTAGTGGGATGTCTGCATGGCAAACTTGAATTCTTATACTAAGAACTG
CAATAATGGGAAAACTAAACTGGTAAAAAAGTTGATTTCATATTATGCAGTGGAGACTTT
TAGAGTTTGAGGCACAAAGGTGACTTAGCTGCTTTGGAATGTCCTGAAAAATATAAAGAA
TTGGGATAATTCCACAGATATTACACTGGTGAGCTCAAGGCTCCAATACTTACAATATTC
GTTGGAGGCAATCATGAAGCTACAAACTACTTAAGAGATTTGTACTATGGTGGATGGGCA
GCTGAAAATATCTACTACTTGGGAGCGTCTGGATTCATTAATATCAAGAAAGGAGATTAA
TCAATAAGACTAGGGGGTGTAAGCGGCATTGAAAAAATGTACGATTACTTTAAAGGATAT
CATGAGAGATCTCCATATATAACAAATCACGACTGGTTAAGAACAATCTACCATATAAGA
CAATTTGAAGTTCAGAAGTGCAAATTGCTATCGAATAAGGTTGACATGTTTATGAGTCAT
GAATGGCCAAATATTATCACTCAAAAAGCAAGAAGAGATTAGGTTCAAAATCTATTGAGA
TTCAAGAAACACTTCTAGCAAGATGTTTCTCAAGGGAGATTGGGATCTCAAGGATTTAGT
GAGATTCTTGAGGAATTAAGACCAAAGTTTTGGTTCTCTGCACATCTACATGTTAAGTTC
TAAGCTGTAATTGATAATTAAACTGAATTCCTGGCATTAGATAAGCCTATACCTAAGAGA
CAATACTTGGATGTATTCCACATTGATAAAGATACAGATAGACTGAACTCAATATTCACT
TAAAGCTACTAGTAGAGAGGTGGCAGTTATTAAAATCATAACTAAGGCCATAACTAATAG
AGGTACAATAATTAGTAACCATAGTATCAATAAAAATGGGTGAAGAAAGGAGAAGCTTAT
GATTAAAATAGAGACTTAATTAATCAATTGCAGCAATAACATTTATAAGAACAAAATAAT
CAAGAGCAGCAATTAATTTAACATTAAGAAGAGGAAGAGAAAAAGGAATCAGTTTCTTAA
ACAATAAATGATTAATAGTTAAAAATTGAACATGATAGAGAATGGATAGCAATACTCCAA
GCAACTTAAAAGTTGATGCCACTTGATGACATGAGATATGACTTCAGATATTTGAACAAG
GGCAACCAATAAATAATGGAAACAATTAAGGCAAACTTTGAAAAACTTGAAAACTCAGAT
ATGTCAATAAACTTCAACAAAGAAGATCATTTTGAGCAATACAAGAATCTACATCCTCAA
ACTGTTAAATTTATTCAAAGATTTGAACTTGATGATAGACTTTTTAACCCTGAAAAGTAT
TGGAACAATTATTAAGTGGATTCAATAGTAAATTAACCTCAAATTGCTAGCACCTAATAA
TAGTAACAATAGACAGAAACAACTTAAATCAGCTAAACTGATTAAAGTGAAGAGTTAAAA
CTCGGTTCAAGGTCTTTCTAGTAAGCATTCAAAAGTGTGAATGATCAAAATGAGATTGAT
TTAGACTTGGAATGA


>Contig6308.0.g39(protein)
MNVAVVGCLHGKLEFLYQELQQWENQTGKKVDFILCSGDFQSLRHKGDLAALECPEKYKE
LGQFHRYYTGELKAPILTIFVGGNHEATNYLRDLYYGGWAAENIYYLGASGFINIKKGDQ
SIRLGGVSGIEKMYDYFKGYHERSPYITNHDWLRTIYHIRQFEVQKCKLLSNKVDMFMSH
EWPNIITQKARRDQVQNLLRFKKHFQQDVSQGRLGSQGFSEILEELRPKFWFSAHLHVKF
QAVIDNQTEFLALDKPIPKRQYLDVFHIDKDTDRLNSIFTQSYQQRGGSYQNHNQGHNQQ
RYNNQQPQYQQKWVKKGEAYDQNRDLINQLQQQHLQEQNNQEQQLIQHQEEEEKKESVSQ
TINDQQLKIEHDREWIAILQATQKLMPLDDMRYDFRYLNKGNQQIMETIKANFEKLENSD
MSINFNKEDHFEQYKNLHPQTVKFIQRFELDDRLFNPEKYWNNYQVDSIVNQPQIASTQQ
QQQQTETTQISQTDQSEELKLGSRSFQQAFKSVNDQNEIDLDLE