Identifiers and Description

Gene Model Identifier

Contig1796.0.g89

Standard Name

DBLH1

Aliases

Contig1796_0_g89

Description

DnaB-like helicase C terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03796 ) DnaB-like helicase C terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1796.0.g89(coding)
ATGCAAACAAACAGTGGCTCTTTCAGCTCAAATCATGCAAGAGGTGGTGCCAATCCTCCT
TCACAACAATCAGGCGCTCCTATCCTACAAACCAACCGCAACTTTGATCACTTGGACTAC
GACGAGAATCTGTACGATTTTATGAAGTCTCAGATCCCCTTCTACATTAACTCCTCAAAT
GAGCACATAAACACCTACATCCTCAATGAAAGCAGAGGTCTAGAGAAGTAGCAAGTTCTA
AACATTTACTATAACGATACAGTCGGCAAGAGAGAGTTTGTTAATGAACTTTTAATGAGT
ACTATTTTAATGAAGTAGTGGGGATAAGGAGATAATTGCAAAGATCTGGAGAACACGAAT
GAGTTAAGTGCGATTATAATTGATATTTAAGGGCAGTTCAGTTGCTATAAGTTCATTGAG
AAATTGCGCGAATATTATGATTCACGTAAATTGTATGATACTGTGGAAACCTTCAATGAA
AATGGAAGGGAACTTTCTGAGAGGGAATTAAATGATAAGTAGATTGCCAATAAGTTTGAA
TTTGTTAAGCAAGTCATGCAGAATCTATACATATTCAGCTGCTTTGATGCAGTGGAATTC
AATTTGACTGTGAGGAGTTTAGCAAGCTTCTTGAAGAAGCAGAAAAATATTGGGCTTATA
GTAGTTGACGGTATACATTTCATAGAGAGTGTGGAATACTATTCTACAAGAGATAAAAGC
TACGCCAGTGAATCAGCTAATTAAGATCCTAAGGATACATCAGGATTAAAATTAAAGAAA
GGTAAAGCAAACAATGTACTCAATATGTCAAATTTCGATATTCCGACTGGAGATGATTTC
TTAGGAGTAAGTGGCTAATCTGCAGCAATTTAAAGCGGAAAGACATCGAATGTTTCAGGC
TCTAGCAATTGCAACACAATAAGGCATAGTTTTAATTTAAAAAGAGGAGCCAAGTCTGGA
TCGAAACTAGACTACAATCAATTTGATAATAAACTTATTGATAGAGCTATAATACTATTG
AATGAATACCAAAAGATTTATCAATTCGCTTTTGTCTCCTGTTTAGCAAAGCCAAATCTG
AGGAAAACTTCAGATATGCTTGAGTAGGTTATGACTAGAGGACTCTTACCAGAGTAGGCT
CCTAAACTTATTTAGAAAGAATCAGATCCTAACAATTAATAAGAAGCTGCAATGCGCTTG
AATGGCTATAATATGGACATAATTTTAGAAGGTTAGATTTAAGCAGCTGAAATTAATGAT
AATCAATTAAGAGAATCTATTAAAAGCTTGAGATAGAATGAAATTTTAATTCTAAGAGGA
GATAGATAAAATAGTTTAATGCCAAGATCAGACCCAAAGAAAATTCATGATGGACTTCTA
ACTTAGCATTTAAGTTGCTGCATTTTGCCATAAACTAAATACTCAGGAAATGACAGGGTA
GTTCAAGAATAAGTACCATATGTAAAGAGATACCTTGGACTTTATGTATTATATAAAGTG
GATGTTAATAGATATAAAATCAGTGACGATGTCATCAAGTCTTTTTATTTTTGA


>Contig1796.0.g89(protein)
MQTNSGSFSSNHARGGANPPSQQSGAPILQTNRNFDHLDYDENLYDFMKSQIPFYINSSN
EHINTYILNESRGLEKQQVLNIYYNDTVGKREFVNELLMSTILMKQWGQGDNCKDLENTN
ELSAIIIDIQGQFSCYKFIEKLREYYDSRKLYDTVETFNENGRELSERELNDKQIANKFE
FVKQVMQNLYIFSCFDAVEFNLTVRSLASFLKKQKNIGLIVVDGIHFIESVEYYSTRDKS
YASESANQDPKDTSGLKLKKGKANNVLNMSNFDIPTGDDFLGVSGQSAAIQSGKTSNVSG
SSNCNTIRHSFNLKRGAKSGSKLDYNQFDNKLIDRAIILLNEYQKIYQFAFVSCLAKPNL
RKTSDMLEQVMTRGLLPEQAPKLIQKESDPNNQQEAAMRLNGYNMDIILEGQIQAAEIND
NQLRESIKSLRQNEILILRGDRQNSLMPRSDPKKIHDGLLTQHLSCCILPQTKYSGNDRV
VQEQVPYVKRYLGLYVLYKVDVNRYKISDDVIKSFYF