Identifiers and Description

Gene Model Identifier

Contig999.1.g71

Standard Name

None

Aliases

Contig999_1_g71

Description

Formin Homology 2 Domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003122401.999790113608142e-24Formin Homology 2 Domain conta
ining protein
SGDYIL159W0.000019995566179747357BNR1 SGDID:S000001421, Chr IX
from 41825-45952, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig999.1.g71(coding)
ATGGAAGCAGATTATCCACCAGAGTAATCTATAGATTCGCACATTGAACCCCCTGAAAGT
TTATCACAATATTCTTCAGACATGACTCATGAGTTTTCTGATATAATATCACCCCCTGAA
AAAAGTCATGAAATTGAAAATACTGACGTAAATCCCCACAAAATGATCAGCTAGTTTAAC
ATGAACCCTTCCAAAAATTCTCACTAAAATATTATCTCCAACAATCCACCAGAAATTTAA
CCCCAAAATTCCCTTACCAAAGCACCATTAAACAACGCTGAGGATTAAGAATTGCAACTT
ATAACATAGCTTCAGTAGCTCTCAAAATCACAACTTATCGAGGAAATTTTGCTACTTAGA
ATGATGAAAGAATCTCACTCAAAAAACAAGTTAAAACTTTAAGAAGAAATAGATAGATTA
AACGAAATTATTCACAAATAAAGGAAGGAATGTGAAGAGTTAAAGACATTAAATTTTGAG
ATAAAAAATCAATCAAATTAGGCTTTATAGAGAAATTTAAGTTCAAATGATGATAGTGGA
AACAATAATAATATGATGCCTCGGTAGAGTGTGGTCATTGATTATGGCGAAAATTATGTA
GTTCGAAATAGCTATAAAGTAGAGCATAACAATAATAGCACAAAATTAGATGTTTAAAAT
TTGGACTAGATAATTGCAAATTTATCAAGACAAGAGAAATTAGCCTTATCAAAAGATCAA
ATCATGAGTGCAAGATTATCAGCTATATTTAAGAAGTAACTTCAGAAAGAGTTTACCAAA
TTCTAAATGTAAACACTTTATCTTAAACAAAGAAAACTTGAGAGAATTTAACAATAGGAT
TAGAAACCATAATCAGATATATAATAGTAGTAGTAGTAGACTTTAAATATAAACGCCAAT
TAAAATGAGATATCTACAATGAATAGGAGTGATTAATAACCAAAGAAGAAAAGTAGGAAA
TTAAATTTAGAGGAGGTCAAAGTATATGATCCAACAATAGCGATTACTTCTAGTGCTTTG
AATTCTAATTAGGCTATTGAGAAGTCACAATTATTGAATGAATCACTGTAGAAAATAGGA
AATTAGATTTAAACTGACCAGAACCCTGATTCTATAACTTAAGTCTAAAATTTTAATAGT
CAGACATCATAGAAATAATACAGAAATATAGACGTTTAAACTGATTCATTAAAGATAGAC
GTTGGTTAAGTAAAAATACAAGAGAGTTCCTAAATTACTTAACAGCATCAATCGTTGATT
AATAAATAAGATGAAATTAAAAAAATACCGCCACCTCCTCCTAGTGGCATGAATAGTTTT
ATTCCGCCTCCTCCAGGGTAGTAGCAAATACAATTGAATTAATAAAAAAATTAAGAATAG
AAGATCGTTGGTTTTATTCAGCCTCCGCCATTAATCATAAATATACCTCCTCCCCCAGGT
ATGCAATAAATGAGTAGCATTCCCCCACCTCCGAGTCAGTTGTAAAATCCAACATTCTTA
GCACCACAAGGAATTCCACCTCCCCCAGGAAGCTTTTAATAACTTAGCTAAATTCCACCG
CCACCTATGGGAATGCTAAATAAAAATATACCTCCGCCTCCAAATACTAATTAAATGAAT
CAACCTCCTTTACCACCACCTGGCATGAATGGCTTTATTCCTCCCCCACCAGGATAGACT
ATGAATCAAGGTATACCCCCACCCCCTGGATTAATGAACAATTAAAGCAATTTTGGTCCT
CCAACATAATCAATAGGAAACAATAACATACCACCTCCACCCGGAGATTAACATATTCCA
CCTCCAAATGGAATGGGAGTGCCTCCACCCCCAGGAGGTTTCAGACCACCTCCTCCTCCA
GGAATGAACGGATTTGGAATACCGCCTCCACCTAATGGAATGATACCTCCAGCATTTGGA
GGACTTCAACCGCCATCAAATATAGGAAATGTACAGCCACCTCCAGGTATGGGAAGTATG
CCTCCACCTCCTCCACCAGGTATGGGAGGTATGCCGCCTCCACCTTAAGGTTTTGGAGGA
ATGCCTCCACCTCCACCACCAGGTGGTATGCCGCCTCCTCCGCCACGTATGGGTGGTATG
CCACCTCCTCCACCTGGTGGAATGCCGCCGCCCCCATTCGGCATGAATGGTATGCCACCG
CCTCCATTCGGTACGGGTGGTATGCCGCCTCCTCCCCTAGGATTTGGAGGTATCCCTTAA
CCAGGATTCAGACCTCCAATGCCAAATATGTAGCAATAGCAAGATCCAAATGAAATAAAG
ATAGAACCTCCTCCATCAGGATTTGTGCCTAAACGTTTGCATTGGCGTGTTATGACAAAA
TTTAAGCTAAACAAATCAATCTTTACTAAAGCCTTTGATCCTAAGAAATTTAAAGCAGAC
ATAGATTATGATCTGTTGAAGGATGCTTTTTGCAAGCGTGAAGAGGACCTTAAGTAAGAA
GAAGAAGAAAAAAAGAAAATGAAAAGCAAAACAAGCAAGGTGATTTATGTCCTCGATTAG
AAACGTGTTTCAGATATTGGTATTCAATTGAGTGGCTACCCAATGAGTATAAAAGACACC
GTGGCTGCTCTACTCAGTTTGGATGACTAGATTTTAGATCAAGATAAAATTCAGAAACTT
TAGCGTATATCGCCTAATCCTGATGAGACTGAGAAACTGCTAGCTTATAAAGGGGATTTG
AGTGAGCTTACTAACATCGAATAATTCTTGATTCAATTACTACAGGTGCCGTCTTTAAGC
GAAAGACTGGAATGCATGCTGTTTAAGAATAAATTTGACTTTGAGTTTAATGAAAATAAC
AAGAACCTTGCCACTCTAGATTCCGCTATGAAAGGAATAAGAGACAACGAAAAAATGAAG
GAGATATTCACAATGATTTTGAAAATAGGAAACTACTTAAATTACGGTACTCCAAAGGGT
AAAGCTTAAGGTTTCCAAATGGAACTTTTGAATTAACTCTCAAATATTAAATCCATAGGA
AAGATGAAGATGTCTCTATTGGAATATCTGATACATTGTATTAGAAAACATGACCCTACT
CTGCTTAATTTCACTAATGAACTTGTTACATGCGAGGTTGCTGCTAAGATTGAATTGAGC
ATTTTGAGTAATAAAATTGCTGATTTTTAGAAGGGGTTCGATAAAATTAAGAAAGAGTTA
CAGAAGACTGAAGACTAGATTAACATTTTTAAAGATGAAATTAAGTAGTTAGAGAGTGTG
GAAGAAAGTGAAAGAAATGAACAATAAATACTTGAGATTGAGACTTTAAATAAAAAAATC
TCTGAGTTTTAAAAATTTCACTCGATTTTCACAAGCTTTTTAAAAGAAGCAGAAGCCAGA
TTTCTTGAAGTTTCTGAACAAGTAACTACTATTCAAAAAGACATAGGTGAGCTAATTATT
TTGTTCGGTGAAGACGATTCTATGAAATCGACAGACTTTTTCATGATGTTTTTCAATTTC
GCCAAAGACTTTTGTAATTGCTATAAAAACATGCTTTTAAGTGAAAAAGTTAAGTAAGAG
CAGGAAGAAAAGAAACAAAGGCAACTAATGAGTGCGGATAAAAATAGTCAGAGTGGGTCT
GTTGTCAGGCGCATAGGTGGGAGTGGATTGAAAATGCCCTTAAGTACTAGAAATAGTCAA
GCTGGTGCATTCCCCGCTCTGAAAAAATCTAATACTCTCAATAGTAGAGACAATAGCCTT
GGAGCTAACAGCAGCAATGAAATAGAATTTAATTAGAAAACTAACAATCCTTTTAAATTC
GCTTTATCGAGATAAAATTCTACAGATGACTTAAAATTATCAAACTAAGCGAAAAATGTG
TTTAATTAGGATAATCTTAAGAAGAATTTGTTCGCTAAACCGCCAGGTCTTCCAGTTCCA
TCTTTGAATAAAAGCGAAAGTTAGACAGCACTTAGAATTAAAAAAGATTTAACTGAAATT
ACTAATTAGAGAGATAAACAGCAAATTTTGAGAAATAAGTTGCCTCCTACGTTGGGTAAT
AGGAATGCTCCTTAAAATTCAACACCCACTAGACATATAGAAGTTACTCTTGATGATATA
AGAAATCATGGTTCTAGAAATAACAGTATAATTATAGAATCTCCCACGCATGAAAACTTG
ACTTCAACTTACTCTTAGCCTCGTGAGCATGAGAAATCAAACTAGAATACAAAATCTATT
TCTCCACCTCCAAAGCGATAAATCTAACAGCAGATTCAGACTTCTTCAATAGCAGCTAGT
AAAAGAACAGACTCTCAACTGCGGAGAGAAGAAGATAAAATATCAGGAGATTTGTTAAAT
TTCGGTCTGTCTACTGACATAAACATTATGGAATAACAAGCCAGGATGAGTGTTCATGCA
AGTATAGTCAGTGCAGCTATTAATGGGGATATCTTAAATAAAAATGGACCAGTATAGAAG
AAATCAAAGAAACTCGTAAATTACAATTAAGAATTGGGAATTGAAATCAAGTAATAACAA
CAGCCATAATCCAAACATTAAATTTAATCACGAATGCCCATGGAGAATAAGAACTAATTT
ATGGACTAGAGATCTCTCCAATCCATGGTTAGTGCTCAATAAAATATAAACAATAATAAA
AGCACAAATGATTTGCGATCTTTAATAAATTAGACTTTACAGTCACGGGGTTAACCTCTT
GGAAATGGAGGCCATACTTCAACAAACATTAGTTCTTCAGTAAATCAAGCAAACTTCACT
AGCAGTATAATGAATGATAATTAGCAAAGTTCAAACATTTTAGCTGGTGCACTGATTACT
GATTATTTTGATGGGCCAATTACTCACAGAGCAATACTAGAAAAAGAGCAGCAAGCAGGA
ATATATTTGGCAGTAGTAACAAGAAGCGCAGTGGCTCTAATTTGA


>Contig999.1.g71(protein)
MEADYPPEQSIDSHIEPPESLSQYSSDMTHEFSDIISPPEKSHEIENTDVNPHKMISQFN
MNPSKNSHQNIISNNPPEIQPQNSLTKAPLNNAEDQELQLITQLQQLSKSQLIEEILLLR
MMKESHSKNKLKLQEEIDRLNEIIHKQRKECEELKTLNFEIKNQSNQALQRNLSSNDDSG
NNNNMMPRQSVVIDYGENYVVRNSYKVEHNNNSTKLDVQNLDQIIANLSRQEKLALSKDQ
IMSARLSAIFKKQLQKEFTKFQMQTLYLKQRKLERIQQQDQKPQSDIQQQQQQTLNINAN
QNEISTMNRSDQQPKKKSRKLNLEEVKVYDPTIAITSSALNSNQAIEKSQLLNESLQKIG
NQIQTDQNPDSITQVQNFNSQTSQKQYRNIDVQTDSLKIDVGQVKIQESSQITQQHQSLI
NKQDEIKKIPPPPPSGMNSFIPPPPGQQQIQLNQQKNQEQKIVGFIQPPPLIINIPPPPG
MQQMSSIPPPPSQLQNPTFLAPQGIPPPPGSFQQLSQIPPPPMGMLNKNIPPPPNTNQMN
QPPLPPPGMNGFIPPPPGQTMNQGIPPPPGLMNNQSNFGPPTQSIGNNNIPPPPGDQHIP
PPNGMGVPPPPGGFRPPPPPGMNGFGIPPPPNGMIPPAFGGLQPPSNIGNVQPPPGMGSM
PPPPPPGMGGMPPPPQGFGGMPPPPPPGGMPPPPPRMGGMPPPPPGGMPPPPFGMNGMPP
PPFGTGGMPPPPLGFGGIPQPGFRPPMPNMQQQQDPNEIKIEPPPSGFVPKRLHWRVMTK
FKLNKSIFTKAFDPKKFKADIDYDLLKDAFCKREEDLKQEEEEKKKMKSKTSKVIYVLDQ
KRVSDIGIQLSGYPMSIKDTVAALLSLDDQILDQDKIQKLQRISPNPDETEKLLAYKGDL
SELTNIEQFLIQLLQVPSLSERLECMLFKNKFDFEFNENNKNLATLDSAMKGIRDNEKMK
EIFTMILKIGNYLNYGTPKGKAQGFQMELLNQLSNIKSIGKMKMSLLEYLIHCIRKHDPT
LLNFTNELVTCEVAAKIELSILSNKIADFQKGFDKIKKELQKTEDQINIFKDEIKQLESV
EESERNEQQILEIETLNKKISEFQKFHSIFTSFLKEAEARFLEVSEQVTTIQKDIGELII
LFGEDDSMKSTDFFMMFFNFAKDFCNCYKNMLLSEKVKQEQEEKKQRQLMSADKNSQSGS
VVRRIGGSGLKMPLSTRNSQAGAFPALKKSNTLNSRDNSLGANSSNEIEFNQKTNNPFKF
ALSRQNSTDDLKLSNQAKNVFNQDNLKKNLFAKPPGLPVPSLNKSESQTALRIKKDLTEI
TNQRDKQQILRNKLPPTLGNRNAPQNSTPTRHIEVTLDDIRNHGSRNNSIIIESPTHENL
TSTYSQPREHEKSNQNTKSISPPPKRQIQQQIQTSSIAASKRTDSQLRREEDKISGDLLN
FGLSTDINIMEQQARMSVHASIVSAAINGDILNKNGPVQKKSKKLVNYNQELGIEIKQQQ
QPQSKHQIQSRMPMENKNQFMDQRSLQSMVSAQQNINNNKSTNDLRSLINQTLQSRGQPL
GNGGHTSTNISSSVNQANFTSSIMNDNQQSSNILAGALITDYFDGPITHRAILEKEQQAG
IYLAVVTRSAVALI