Identifiers and Description

Gene Model Identifier

Contig9906.0.1.g90

Standard Name

None

Aliases

Contig9906_0_1_g90

Description

Cyclin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • regulation of cyclin-dependent protein serine/threonine kinase activity (IEA) | GO:0000079

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007324607.001446474249442e-19Cyclin, N-terminal domain cont
aining protein
SGDYER059W0.00000000000009996062864481225PCL6 SGDID:S000000861, Chr V f
rom 272624-273886, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9906.0.1.g90(coding)
ATGGATCTAAATGATAATAAAAGCTAAGATAAAGCTTGTAGTCAGGGAGGTTTGAACTAA
ACATTGACCTCAAAGGTTGGTCGCATCTTGCAGCTTCTAGCGCAGCTAGGCGATTAAATC
CAGCCAACTCAAGTCATTACACCTTTCCATAGTACAATGCCTTCAAATATTCCAGTTTAG
GCATACTTCCTCTACGTCTCCATCAACTCGGGATTAAGTGACCAGCAAGCAATCGTGAAT
TTGGTATTGATAGAGCGCATTTGTAAGATGGCCACAGCTCGCGGAGTACCAATCGTGATC
AACTCTCTCACAATTCACAGGTTGATTCTCGCCTCAGTGTTAATCACATCTAAGTTCTAT
AACGACATCTTTTACGGGAACCACTACGTAGCGTATGTGGGAGGCGTGCAGCTCGAGGAA
ATAAATCTGCTCGAAGTAGAATTTTTAAATTATATTGACTGGTGCCTTTGGGTGGACACA
CCCGAGTACGAACTTTATTTGAACGGAGTACATTAACATTTTGAGCAAATTGAGATGTAA
CAACAAGTCATGTAGAACTCTCTAGTCCCTTAAGGACCTCAAGCCCATTGCAGACAAGAG
ATTGATTCTCAATCTCAAGGCGCTGGCATTGTGGCAAACGACATTTGA


>Contig9906.0.1.g90(protein)
MDLNDNKSQDKACSQGGLNQTLTSKVGRILQLLAQLGDQIQPTQVITPFHSTMPSNIPVQ
AYFLYVSINSGLSDQQAIVNLVLIERICKMATARGVPIVINSLTIHRLILASVLITSKFY
NDIFYGNHYVAYVGGVQLEEINLLEVEFLNYIDWCLWVDTPEYELYLNGVHQHFEQIEMQ
QQVMQNSLVPQGPQAHCRQEIDSQSQGAGIVANDI