Identifiers and Description

Gene Model Identifier

Contig9892.0.g55

Standard Name

HOP2b

Aliases

Contig9892_0_g55

Description

Tat binding protein 1(TBP-1)-interacting protein (TBPIP)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
  • ( pfam09719 ) Putative redox-active protein (C GCAxxG C C)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011904405.00094715178354e-25Tat binding protein 1(TBP-1)-i
nteracting prot...
SGDYGL033W0.000004000864880866421HOP2 SGDID:S000003001, Chr VII
from 435625-435679,43575...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9892.0.g55(coding)
ATGGGTCCAAGGAAGAAGAAGGGAGATATTAAGGGAGCAGATGCTGTTTCAGTTAATGGC
GATGATTAGCCATCTGGAATCTCACTAACTTCAGATAAATTAGATAAATTAAAGCACAAA
GGCAACAATGATGATGAAGATGGAGAGGATGAAGTGGATTAAAGTGAGGTGGCCACTGCA
GGTGCAGCTGATGATGATAATAGCAGCAGTACCAATCTACAGCCACCAAAGAAAATAAGG
AAGAAGAGCAAAGATGCCAATGTTGCAGATGGTAAGAAATCCTCGAATGCAGGTAAGAAA
GGTGGAAAAAGCAAAGGAAAAGAGTAGCAAAAGGAAGCTTAAGAGGAAGAACAGCCTGCT
GATGAAGAAATGTAAGAGGATGCTGAAAATGGTGGAGGTAATGGTGATGATAGTATAGAT
AAAGCAAACACTCCAGTAGCTGCAAATGCACCACCGAAAGAAAGCAAAGATAATGAAGAA
GCTGGTTAAGAAGAATAAGCAGCTGAAGAAGAGGAAGAGGAACAAGAAGAGGAATAAGAG
GAAGAAGATGAAGAAGAGGAAACCAAAGATACAAATACCGGAGGTGCCGCCAAATCCACA
GTTCCTAAAAGACCAAAAACAGGTCCTGGAAGTTTGAATGAACCTAAAAAAATGATGAAT
GACCAAGAAGCTGAACAGGCCATAGCTGAGTTCATGGAAAAGTAAAACAGGCCATACTCA
GTGTAAAATATCCTAGATAGTTTTCAGCAAAGAATCAAGAAAACCTAATGCTAAAAGATA
ATGGATGAACTAACTACAAGCTAAATTTTGACTTGCAAGGAGTATGGAAAAGCGAAGATA
TATCTGATAAATTAAGACGTTTTTGAGACTACAACAAATGAAGAATTATAGAAATTAGAT
GATCAGATTAAAGTTCGTAAAGATGAATATGATCTACTGATCGCTGAATACAAGCAACTT
CAATCAAGATTAAAGGAAGTCAGTCAGGGGTAGAGTAATACAGACATGAAAACTGAAATA
AAAAATATAACTAAAGACATTTAAACAAGCAAAGTCGCACTAGAGCCATTTATCAGTGGA
GGCAGAAAATTAGTAACATAAGCAGAAATAACAAAGGCAGATGCAGCCCTCAAGAAAATT
TAACAAGAATGGAAGAAACGTAGAAGAGCGTGCAATGATATCGTGGATTAAATAAGTGAG
AGTGCGGAGATGAATCGCAAAGATTTTATTAAGAAACTTGGCTTGGAAACTGATGAAATG
TATAATGTTGTCTGTCCCATATGA


>Contig9892.0.g55(protein)
MGPRKKKGDIKGADAVSVNGDDQPSGISLTSDKLDKLKHKGNNDDEDGEDEVDQSEVATA
GAADDDNSSSTNLQPPKKIRKKSKDANVADGKKSSNAGKKGGKSKGKEQQKEAQEEEQPA
DEEMQEDAENGGGNGDDSIDKANTPVAANAPPKESKDNEEAGQEEQAAEEEEEEQEEEQE
EEDEEEETKDTNTGGAAKSTVPKRPKTGPGSLNEPKKMMNDQEAEQAIAEFMEKQNRPYS
VQNILDSFQQRIKKTQCQKIMDELTTSQILTCKEYGKAKIYLINQDVFETTTNEELQKLD
DQIKVRKDEYDLLIAEYKQLQSRLKEVSQGQSNTDMKTEIKNITKDIQTSKVALEPFISG
GRKLVTQAEITKADAALKKIQQEWKKRRRACNDIVDQISESAEMNRKDFIKKLGLETDEM
YNVVCPI