Identifiers and Description

Gene Model Identifier

Contig9887.0.g77

Standard Name

None

Aliases

Contig9887_0_g77

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007119805.0020095550341075e-51small GTP-binding protein doma
in containing p...
SGDYER031C9.999888128184441e-42YPT31 SGDID:S000000833, Chr V
from 214747-214076, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9887.0.g77(coding)
ATGACAGAAATGTTTAAAGTGGTCCTGTTGGGGGATACGTCAGTAGGCAAGACCTCCATA
TTGCAAAGATTTGCCAAGGGGCAATTTAAAAAGGACTAAGATGCTACAATTGGCGCACAT
TTTATGTCTAAGATAGTAGAGCTGCCGTAAGCTAATAATGCATAGATTAAGCTGTAAGTT
TGGGATACTGCTGGTCAGGAAAAGTATCGCAGTGTGACCCCCATCTATTTCAGAGATGCA
GCTGCAGCAATATGCGTATTTGATATTACCAGCAAGTAAACATTGGAAAACGCAGAGGGT
TGGATTAATGATCTCAGAAGTTATGCCCCAAATCATATCATCATCGCATTAGCTGGCAAC
AAGAGTGACCTCTATGCTTAGGAAGAAGTATCAATTTAAATGGGCAAGGACTTCGCTTTG
AAGCATCAAGTTGAGATCTTCCAATAAACTAGTGCAAAAGAAGACACTGGCATCAACGAA
CTATTCCTAAAGATAGCAACTAAAATAGAGAAAAATAAATCTGTAATATTGGCTAACAGT
TCGAAAGCAGTCAATTTAAATGGGAGGGAAGAAACTGGTGGATCTGACAGAAAGAAAAAG
AAGAAGGGGTGCTGCTGA


>Contig9887.0.g77(protein)
MTEMFKVVLLGDTSVGKTSILQRFAKGQFKKDQDATIGAHFMSKIVELPQANNAQIKLQV
WDTAGQEKYRSVTPIYFRDAAAAICVFDITSKQTLENAEGWINDLRSYAPNHIIIALAGN
KSDLYAQEEVSIQMGKDFALKHQVEIFQQTSAKEDTGINELFLKIATKIEKNKSVILANS
SKAVNLNGREETGGSDRKKKKKGCC