Identifiers and Description

Gene Model Identifier

Contig9885.0.g74

Standard Name

None

Aliases

Contig9885_0_g74

Description

TPR repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006834000.000000000004997916451710233TPR Domain containing protein
SGDYGR047C0.000030009396760408108TFC4 SGDID:S000003279, Chr VII
from 589469-586392, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9885.0.g74(coding)
ATGCTGAATGTGCAATATGAAAGCGACGATGATGGAGACTCTATTCAATCAGACCAACTT
TCCTTATAATAACATAACTCAAATAAATTTGATGAGCCAAACAAATTGAACATTTTGAGT
TCGAAAAAAAGTGATCTTGATAAATTTGTGAAGAATGAAAAGAGAAGTTCGAATTCCTTG
AAAAATACAAAATTGCTTAAAAACTAATAAGATGAAGAGGAACGAAAATCTAGTCAGGAA
AATTCAAGTGTTTATATAAAGCCAAATATTATTAAGAATGAGAGTTCATCTAATGAATAT
GCTACGGACGAAGATTAATCTAAGTCATTATCAAGAACAAATGAAGTTATTAAATAGAAA
AAAGTCAAACCTGATTCATTTTAGAAGCCTCTTACAAAATTTGAGCTTTAAGAAAGAGAT
AGTAATGATAACACAAACATGAATAGTAACAATCAGTAGCCAGCTGAACTTGAAGAAATT
GTGCAAATGTTTGCACATGATTTGCAACAATCAATTAGATAGAGATTCAAAAATAAGGCA
TTAAATTAGCAGAGAAATTAGGGAGGAACTGGTCTCTCTAATAGCGCCAAGAAACTTCCA
CTTGAGATTTAAGCATTGATGGGTTAAGCAAATAATTTATATGCATTCGAAAAGTTTGAT
GAAGCCATTGACATTCTGCAATAGATCATCACTAAGCTCCCAGATCACGCTGAGTCTTAC
TCCACAATCGCTAGTATCTATGAGGAAATGAATGAATATGAGAAGAGTCTTAACTTTGGA
GTAATGGCAGCATTTTTACTGAAGACTGATGTAGAAAGATGGTAAAAATGTGCAAGTATC
GCAAAATTCTTATAAAAACTTCCAATAGCTATTTATTGCTTAAACAGAGCAATTAAGCAA
AGCTCTCAAGAAGATGTAGATGAAATTCTAAGAATGAAGTTTGAGAAGATTGGAATTTAC
AAGATGCAAAATGATTATAGCAGCGCTATTAGAACTCTTTAGAAATTGATTAACAAGTTC
CACACTTAAGACTTAAGGAAGTCTTACATGCTTAACATGGCGCTTGCCCAAACTTATTTT
GAGTAAGGTTAACCTTAAAAAAGCTTTGAAGTTCTTGATGAGCTGATTGAACTCAATTAA
AACGATAGCAATTACTTAATAGATATTCTTCTTCTCTATGGAGATATCTCATAGAATTCT
TAGAAGTACTAAGAATTTGTAAATCAAATGAAGAGGGTTTCAATTTAAGATATCCTCAGA
AAATTGAAGCAAATAAATGATTATAAGATAAAAATTTTCTAGATTGATGTAAGAAAGTTC
TTATGCCTGATTGACTCTGGAGAAACATTTAATTTAAGTAGTTTTTAAGAAAGTATTAAT
GAGTTTTACTAAAATAACTTAACTGATAAACTTGATTAGTATCAAAGAGTTGTTAGTTCA
ATTATTATGCTAGCTGATAAACTTGAGAATAGGGTAAACGACATAGCAAATACCACAAAG
ATTTATGAGACATTGCTTTCAATAAGTCTTTAAATTGATCAACCAAACATTCTATACAAG
CTTGGTTTACTATACTAAAAGACAGGTGACAACGAAAAAGCGAAAGAAGCTTTAGAGCAA
GCATTTATTAGATGCCCAATAGTTCAGAATGCCTAGATAAGAATTGAGCTTAGTACAGTC
TATAACTAATTAGGAATGAACAAAAAAGCAATGAGCATTTTGAAGAATCCCTTTCCATAG
CAATAAGCAGCCAATCAAAATGATAGCACGATGCTAAAAAAGAGAAAGAGAAAGCCTGTA
AAATCTAAGGATGAAGACATCATCATGAGTAGTGAATCAGAGCAAGAGGAGGATGAAGTT
ATTATGGATATGTCTGATTCCTGGAACATTTTTAAACCACCTAATATGATAAACATGCAA
CCACCCTCTCTTGCAGGAGCAGTTGCACTTCCATCTAATAACCTTAATGGTAGTGATCAC
ACAAGCGAAGCTGGAGGAACTTTTTCTGATAGTATTATGAGACCTGACTTTAGGCTTAAA
AAGGATGTCAATTATTAAAAGAAAGAACAGGCTGGACAATAACAGAATGACAGAGATTTC
TTACTCAAAAGAAATAGAAAATTATAAAAGAGACTTCATGGAAAGAAAGACTAAGTTGAA
GAGAATCAATTTAACTAGACTCAGGACATTATACAGAAAATGAAACAACAACTGCAAGAC
TTCAATGCTGGGGAATATATCATGCTTATGGAATAATGTAAACTATACATCAAGCTTGAA
GAGAATGATTAATTGGGATAGTCACTAGAGAATAAATTCATAGAAGTTCTTAAGAATATG
AAAATCAAGCAAGATTTACAAGATTTGATGTACAAATAAAACTTATACAATAATAGTGAG
ACTCCATTAAAGGAATAATTTTTCATGAGAAAGTTTAATGCTGATTCTGATAAAGATGGT
ACTTCAAAGGTAACTTAACAAGCAAAGATTTAGATCATTGACGAAATAGATTAATACCCT
AATATCTTAACTCAAATTAAGCCAGAGGAGATAATAGATATCACATTCAACTATCTAAAA
ATGCTAATTTAAAAAGACTTGTATAATTAAGCAGGTGAAATAGTCGATATTTTTTAATCT
GTTGAACTTTTAATGCAAGCTATCCAATAAAATGAAACAAAATCGAAAATTTTCTATGAG
ATTGCTACTATCGTGTATTATTAATCTTAATAGCCAATTAAAGCATACAAAGCCTTGCGC
TAAATTTCAAACCATAATGACATGCTAAACTGGGCTATGATGGGTTGCATAATTTAAAAA
AATGAAGATTCTAGTTTTTGCAGATCTTACTTTAAGAGAGTTTTTTAAACAAAGCAAGTC
CTAAACCCTTTCATTTTGATGATTTTAGGAAATAATTATCTCTAAAAGTAACAGATTGAA
CTCGCCATAAAGCACTACTGGTTGTTGCATAAGTCTTTTCACACAAAGAATTCTCTATTA
AATTTGACACTTGCAATTTCTTATTTAAGCCAGTCATATTAGAGAACCAATGAAGATAAG
GAGCAAAGTGTAAAACGATCAATCGCTCTCTTTATGAAATACGCAGAAGCTAGGGATGAT
AAAATTGAGGTATAGTATAATATAGCCAGAGCATTCCAGTTTATGGGATTAAACATCAAT
GCCAGAGAGATTTACGAAAAATTAATTAAGCTTGATAAGACCTAACTAAATGATGATCAA
AAGCAAATTTAAATCTAATCTGTATTCAACCTAAGTCAATTGATTAAAGGAGCTGGTTTA
AATACAGGAATTACCATTACCGAAGGATCAAATATAGAAAGAATAAAATACAACAATTTA
AGACTTGCTCATGAGCTAATTATCAACAATATAATCATAGAATGA


>Contig9885.0.g74(protein)
MLNVQYESDDDGDSIQSDQLSLQQHNSNKFDEPNKLNILSSKKSDLDKFVKNEKRSSNSL
KNTKLLKNQQDEEERKSSQENSSVYIKPNIIKNESSSNEYATDEDQSKSLSRTNEVIKQK
KVKPDSFQKPLTKFELQERDSNDNTNMNSNNQQPAELEEIVQMFAHDLQQSIRQRFKNKA
LNQQRNQGGTGLSNSAKKLPLEIQALMGQANNLYAFEKFDEAIDILQQIITKLPDHAESY
STIASIYEEMNEYEKSLNFGVMAAFLLKTDVERWQKCASIAKFLQKLPIAIYCLNRAIKQ
SSQEDVDEILRMKFEKIGIYKMQNDYSSAIRTLQKLINKFHTQDLRKSYMLNMALAQTYF
EQGQPQKSFEVLDELIELNQNDSNYLIDILLLYGDISQNSQKYQEFVNQMKRVSIQDILR
KLKQINDYKIKIFQIDVRKFLCLIDSGETFNLSSFQESINEFYQNNLTDKLDQYQRVVSS
IIMLADKLENRVNDIANTTKIYETLLSISLQIDQPNILYKLGLLYQKTGDNEKAKEALEQ
AFIRCPIVQNAQIRIELSTVYNQLGMNKKAMSILKNPFPQQQAANQNDSTMLKKRKRKPV
KSKDEDIIMSSESEQEEDEVIMDMSDSWNIFKPPNMINMQPPSLAGAVALPSNNLNGSDH
TSEAGGTFSDSIMRPDFRLKKDVNYQKKEQAGQQQNDRDFLLKRNRKLQKRLHGKKDQVE
ENQFNQTQDIIQKMKQQLQDFNAGEYIMLMEQCKLYIKLEENDQLGQSLENKFIEVLKNM
KIKQDLQDLMYKQNLYNNSETPLKEQFFMRKFNADSDKDGTSKVTQQAKIQIIDEIDQYP
NILTQIKPEEIIDITFNYLKMLIQKDLYNQAGEIVDIFQSVELLMQAIQQNETKSKIFYE
IATIVYYQSQQPIKAYKALRQISNHNDMLNWAMMGCIIQKNEDSSFCRSYFKRVFQTKQV
LNPFILMILGNNYLQKQQIELAIKHYWLLHKSFHTKNSLLNLTLAISYLSQSYQRTNEDK
EQSVKRSIALFMKYAEARDDKIEVQYNIARAFQFMGLNINAREIYEKLIKLDKTQLNDDQ
KQIQIQSVFNLSQLIKGAGLNTGITITEGSNIERIKYNNLRLAHELIINNIIIE