Identifiers and Description

Gene Model Identifier

Contig98.0.0.g99

Standard Name

None

Aliases

Contig98_0_0_g99

Description

Chaperonin 10 Kd subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007706903.0000451088882257e-25chaperonin, 10 kDa family prot
ein
SGDYOR020C9.995317835403734e-19HSP10 SGDID:S000005546, Chr XV
from 370844-370524, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig98.0.0.g99(coding)
ATGTTAGCATTCAGTAAACTCAGACCACTCATGAATAGAATCATTGTGAAGAAGGCAGAG
CCACTCACCAAGACCAAGGGAGGAATCTTGCTCCCAGAGAGCAGGCAAGACCAATTGAAC
TTCGGTGTAGTCGTCGCAGTTGGACCAGGCAGACATCTCGATAACGGACAACTCAGACCA
GTCTCAGTCAAGGAGGGCGACACCGTCCTACTCCCAGAGTATGGCGGAGCCAAGGTCACT
CTTGGTGACAACCAAGACTACTTCATTTACAGAGATGACGATATTGTTGGTACTCTCCAC
GACCCAACCAAATGA


>Contig98.0.0.g99(protein)
MLAFSKLRPLMNRIIVKKAEPLTKTKGGILLPESRQDQLNFGVVVAVGPGRHLDNGQLRP
VSVKEGDTVLLPEYGGAKVTLGDNQDYFIYRDDDIVGTLHDPTK