Identifiers and Description

Gene Model Identifier

Contig9740.0.g65

Standard Name

None

Aliases

Contig9740_0_g65

Description

Vpu protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007035309.9981864321491e-40Chlamydial polymorphic outer m
embrane protein...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9740.0.g65(coding)
ATGACATTAGCTCTGGAATCAAATGCTCAGATGCCTAATACAACTATATCAATAACATGT
GCTAAGAATGAAGTAGGGATCTCGCCACTTTCGTAAACTTCACTGCAAGCTACTGGATAC
TGTTATGCTTGCAGAGCGCTCTTGCCAGGCTGCAGATCTTGCTCTTCAACTACAATGGGA
TAGTAAACTTTAATATCTTGTGATGAATGTGAAGAGGGAATGTATAAGTACAAACTTACT
AAATCTGTAAATGCTGGTCCAAATTAGACAATCTCAGCTTCAATTAATGTCTGTGTACCA
GACTGCCCTTCGGTTAATTTCTAATTGATTAACAACCCTATTACTTAAAAATGTGAGTTT
TTGGGGTTCTACTGCAAATACGGAGACTTCTATAATGGCTGCAAATAATGCTCTCTTCAA
GATTAACACTATATCGCCGGGAATACAGGCTTTATTACAACTATAAATAGCACTTTAGTG
TCAGCTGCATCATTTGTGAATGGAAATAATTTTCAGTTTTGTACATAATGTTAATATACT
GAGGCAACAGTGCAAACAAATTAACTGAGTTACTTCTCCAAATGCTAATTTAAAAGCAAA
TGTGATGCAGACTTATCATTACAGATGAGTAACTACTGTTACGAATGCTCACTTTGGTAA
ACTCCGCCCAGTGAATACAATTGTACTAAATGTTGGAATCAATATACACTGAATACAAGC
AGTTTAACTCTGAAGACAGTAGGAGGATAAGGCGGAGGAGGCTCTTCAAAAACTTCATGT
ACATCCCAATCCTCAGCTTGTGATAATACAGTAAGCAATTGTAAAGAATGTTCCTCAACA
AATACTACATAATGTATCTTCTGTAGCCAGGGTTTCGTTTTATATAATGGCTAATGTTTA
TCAGTGTGCCCAGAGAAATATTTTGTAGAAATCACTCAAGACGATACCACGTTACTCCCT
AAAGCTGCTTCATGCTCTTAATGTGACACATCTTGCTATTCTTGCATAGATGGTTTAAGT
TCAAGTTGCACCAGCTGCTTGAATGGATAGTTTCTTAGCATATCAAGTGTGTTTACACAA
TCTGGTACATGTATGGATAAAATTGCTTATACAGGCTCAACCAAGTACATTTCAATAACT
TCGATAAGATCTGCCAGTCCTTCAGTAGTAATCAGTTAAGATGAACAAACAACTTCATTT
GATAACATATTTGATGCTGTGAATTAAGCTTATTAAATTGCTGCCCCTTATTCTGGGATG
ACAATTGAAATACAAATGAATGATCCCACTTATTACATTCTCAAGAAAGATCTCTTGAAG
GTCTATTACAACTAAAAATTTAAAGATTTCATAAATCCTCAATTCAACCTAAAGATTACA
TCCACTCAAGCTGCTAAAACAACAATTTATAATAAAATTGGAGGTATGTTCTAGATTCAG
GTGCCTCTATCGCTTTCAATCGAAAATATCATAATTGATTCATCAGACTCAGTAGTGGCC
TAATCTACTAATTCAATATCTTGCAATGGAACTGCAGATACATATAAGAACTACTTCATT
CCATATCACATTCTAATTTACCAAAGCACTTTTAAAAACATTGGAACATGTGGAGCTATA
ATAAGTAATGATTACTTGAATTCGGGTGTTTCCTACTCTGGCGATATTCAAATGCAATCT
ATTTCAATTGGTTATTATTTAACTACTTAAAATGCATATAAGGACTCTTTTACAAATATT
TACTACAATAAAACGTACACTAATATGGCTAGGCAATCCTCTAATATCATTTTTCATACT
TCAAGTTTCTAAAATTTCCACGCATTGAAAGTATTAGAAACAAACTTAACTGCAGTTTAA
GATTCAGCTAGAGATCATGGCCTGGTACTATAATTAAGGGATTTTAAGGGTAATGTGCAT
TTTGAAAGCTGTACTTTTAAGGAAATTTAGTAACCAGTAGCTTCTGCCAAGTTTAATGTC
AGTGCTGCAGATAAAAATAAATATGAAATGGAAAATTATATACACTATGTCATCATTGAA
GATGCAAGATATCTGCAATTTTAGCGATTGATTAATTTAGTTGATACGCATGAAACTAGT
ACAGTATACTTAAAGAGCAATTCCTTTACAAACCTGTCACTCACCAATGCCCTAATTAAA
GTTAAGTCATTATCTTCGGAGTATTTGGTGTATACGATAATTGAATCCAACACATTTTCA
AATATTATAGGTTTGATGGGTACAGGTATCTTGCATGTGGAAAAAGGTTTATACTAAAGT
TTATCCACAGCTGAGTAAGCTTTGCAATGTGGAGGAGGCACTCACATTTAATCCAATACT
TTCTCAGAGATTACTGGCACTGAGAGTGTTGATATTGGGTTGATGTTTTTCGGGTGCAAA
GATTTAAGCAAAGCTACGAGTGGATAGTCTACTTCAATGGAAGGTTTAAATGATAAATTT
GGAGCTGACTAGAACTCTTTAAATTCAAACTTAATAGGATTATAAACTTCTATGTAAACA
CTAATTAGTGGATCTACAACTGCAGCTACCATCTCAGTGTATAGCGGAGTGGTAAGTGAT
TCCTTCAGCACTTCGTATACAATAAACAAATATCAAACTACTCTGAAGTATAACACTTAT
TATGATTGCACATTGGGTGTAACAATTCTCAGTAATGAGCATTACTATTTGGGCAGTCTC
ATAGCCACTATGGGTGTTATGGCCATTTAGTTAACTGGAGAAAATTATAAAAACATTGGA
TCATTTACTTAGGAATACTTTAATATTATTGCTTCTTAGCTAGATCTTTCTCTGACCGGT
TAATAAAAAGAGTTTCTGAGCAATACAGATAATAAAGGAGAATTTTTCCGTGATAGGCAT
ACCTCTTTTAGTTCTGATTAAATGATGGCAGTAATTGGGTATTTCAAAAATTATGTGGGT
ACATTAAATATAGGGGACACAAGTGGCTCAACTTACAATTATTTCTAGAATATAGTTGGC
ATGTTCAATCAGCATGCTATTGACACACTTTCCTGGTTGCCAGGAAATACTGCTTATCAA
TATGCAAATAAATATTATCAAGGATTTTGTTCCCCGATGTTTTACTTAGCTAGTAACAAT
ATAAGCACTCTTAATTTCTATAACAACGTATTCCAGAATAATTATGCCTACTACAGTGAT
GTTTAGAGTACATTTGTAGCAAGTATAATAGAATTTGACAACACTTTTAAAGATTAAGAA
ACCACTATAACTTTTAAAAACATAAAAGTGTACAATAATTATTAAGTTTATGGTTACTAC
TACTTCAATATAGAAGGAACCTACATCACATTTACGAATGTAGATGTTCAAAATAATGGT
TACCATTTCACATTTTTAAGCAACAGCTACGATTCAAGTTATAATTATAAATATCAGGCG
CAACCTATATTTTTGATAAACTTTGAAGCTTAAGATTCAAGTAGCTATTTAAAGATTACT
AGTTGTACTTTTACCAATAATACAGCCGAGAACACACCACTGTTTTAGCTTGAATCATCA
AATTCCTAATCTTAAAATACCTTTGCAGATTATTACCTCGTTACCTTGGATAGTTGTACT
TTTACTTCAAATATCGGGACTACCTCTTCAATCATGCTAAACTAAGACTCCGACTTGAAT
TTTAAGCTCCTTTTTTCATCTTGTACTTTTAAATCTAACTTTGCCACTTACGGACTGATA
AAAGTTGTGTCATATTTAGAGATGCTTGATATGCTGTCTTGCACTTTTAATACGAATACA
GGGACACTTGCCAAGTTATTTTACTTCACTAACAATCTAATTAAATATATTGAGGTAAAT
TAGATATAATTTAAGACCTATTTTACAAAATAGATTAGAAAAGCATCCATTTATGAGACT
TAAGTAGACACAGACGATATATAGGAATATTTACTTGAGGATCTTAGCACCTATTATCTG
TCTAGCAATCCCTCTTTAATTGTTCTATCAGGTCAATCAAACTTTAATATTACTGATTCT
TATGTAAAATATATTCATTACGCTTATTATGGAGCTTTTATGACTCTTGAGTCATCCTCA
TCTGCAAATATTACGAATGTCAATATCAAAGGAGTTATTTCAGCTCAGGATTCATCTTAT
TTGACAGTTGACAATACAATATTCGTTGATAATTTTGCAGTGGAAATAAGTGTATTTAAA
GTGAGTGCTACTTCTGATATTTATGTCAGTGGATCTTAGTTTTATTCAAACTATGTCACA
AGTTAAAACTCAATAGGACAATTTATTCAATCTAAAGGGTCTTCTATTAAGAACTCTGTA
ATTAAAAGCAACTATATTTCGTCTGGAGGATCTTCAAACACTCTGCAATTGATTTCCTCA
ACTGTGGTTTTTGAATATTTAACTTTCAAAGATAATTAAGCTTAGAAAAATTCAGCTGGA
ATTTAAGTAGTACTCTCTAACGTGTATTTTAACTACAGTACATTCTAAAATACTAATCCA
AGTACAGCTGCTACAAAGATATCTGGCGATTTTATTTATGCAATTAGTGATTCAAATATC
TATATTAATAACACAAGTTTTCTAAATGGAAGAGCTAAAGATGGTGGAGCAATCTATCTT
CTTGGTTACTCCAATCTTACTATAGAAAATTCACATTTCAATTCATGTTCAGTGGACAGT
TCAGGCGGAGCAATTTACGCTGCTTCATTTGATCAATTTTTAATAATAAATTCCCATTTT
TACAAGAATAAAGCTGGAATACAAGGAGATGCCATATATTCTTCGAATTCACTTGGATAT
ATAAATATAAACTCAAGTAGTAGTTTTTACTCTCAGGCTTCTTCTAATTTCTTGTATCTT
ACTTCAATAGAAAGCGTAAACATAACCAATGTTACAATTTACTCATCAGCAAAAAACGAA
TCAGACTCTTCCAAGTTTTCAGGTATCTTCCTTGAAAACATAAAAACTTTCCGATTAATC
GCAAGCACTATGAAACAGCTAATTGCAAACACTACAGGAGGATGCCTATATATCACAGAA
AACTCAAACAACAAACAAACTGCAAATAGTGTGAGATATTTGATAGGTAACAGCACTTTT
GTAAATTGCTCAGCTCTATAAGGCGGTGCGATATTTCTTTCAAATGTTTAAGGCGTGATG
ATAAACGATTCTTCACAATTTATCAATAACACAGCTTATATATCTTATCTGCAAGATTAA
ACAAGCTATGAGTATGGTGTGGGTGGGGCTATTAATTTCTATTGTTAAAGTGGTGAAACT
AAATGTACTTTGAGCATGGAAAAGGTAGCCTTCTATTAAAATTATGCTTAAGTCAAAGGT
GGGGCTTTTAATTGGAATTATCTTGAGCCAACTTAGAAGACTTTGACTTTTACAAACAAC
ACTGCAAAAATATATGGAAACTCAATATCTTCAGTACCCAAGACGCTATCCCTACTCACA
GCAACTCAATATCAACAAAGTTAAGAAAGATTTGCAACAAGTAGTGATTAATCACTTCTT
ATGTTAAGAAGATCAATGGACAGCTCTAACAGTTTGTATACGCTATCTAGCTAAAAATCA
GGAGGAAATTTAGACCCTCTATACTTTGCACTCCTCGATAAATACTCCCAAATAGTAGCA
ACAGATTTAGACAGTACTCTTTTCTTGAGTGCAATTCAAAACTCAGCTCTCTAATTCGCT
TCAACTTTTGAGACAGTAACTTCCTTTGGAATATCTAATGGAGCTTTTGAAGTTAGCAAT
GTTGTGTTTGTGGGCACTCCAAACTCAGTTTAAACATTTAACATAACAACAGATGGCATA
GATTTCAGTATTCCAGATAATGCGGCTTACTACTCAACTTCCACAAGCACTTCACTGTCA
TAAATATAGCAAAGTGCCGCTGTGGCTATCAATAAGCAACTGTATGTTACAATATCCTTA
AGAGATTGTGAAGCTGGGGAGGCCTTACTATCCTCTGGAAAATGTTCAGACTGTGCAGCA
GGACTATATCTATTAGAATCTCCAGATGAAGTAGTCTCATGCAAAGAATGTTAATCAACT
GTTTCTTATTGCTATGGTAGAAATGAGGTGTATCCAAGAGCAGGTTATTGGAGAAGTAGC
ATATACAGTGATAATTTTATTAGCTGTAGAAATGATGTAGCTTGTCTGGGCATGAATCCA
CCAGAGAATAATTCACTGGGAGCTTGTGAAGTGGGTTACTAAGGAATTCTATGCACTGAT
TGCCAGATAAATTACTCTCGTACTGGAACTTATGAATGCTCACTATGCCCTGATGCAACA
TCCAATAGTTTCAAGCTATTCGCTATATTCGTTGCTGTTATCTGTGCTCTAGTCTTTCTT
ATAAGATCAACAATCGCTGGTGCCCTTGAGCAAAAAAACTATCTATCTGTGTTCATTAGG
ATTTTATCAAATCACTTCTAGTTGCTAATTATTACAGCAAGTTTTGATTTTTAGTGGCCA
ACGCAGCTTCTCGAATTTTTCAACTCAGTTAAACCTGCATCTGAAGCAACGACTCAATTT
TTATCTGTTGACTGCTTTATTGATACAAGAAGTAGCAACTCTGATAAAGGAACAATAAGA
GCGTTTTATTCTAAAACAATTATTCTTGCTCTAGCCCCAATTCTTGTAGTAATTATGTGC
TTTGTAATTTGGGTTATTATCTTTAAAATCTAGGATTATAAGTAAAAGAACAAGAAAGAC
GAGATTACTGTTAAGCTTGAAGAATTTAGGGAGTAGAATGAATTACAAAGAAAAAATACC
ATAGCTTTGCACAGATTTAACACGAATTAAGATATTAAAAATTTGGGAGTTAATTCAAGC
AAGGAGAAACTAGTAAGTACTAGCAGAAGTAAAGGAAACATTTCTACTTAAAAACAATTA
AAAATCTCGCATTCAGATGATGTAGATGAAGTTCATTTCGATAGTAAATCCCACTCAGGC
AAAACCTAAAAAACCTCAAAACCCCTTTATCAACTAAATAATTATACAACTACTCCTCGC
TAAAATCCAAATCAAATTTAAACTGACGGTTCTGATAATCAGAACCACCATTTATTAACA
GAAAATGAAGAAGAAATGCTTGCTCAATTGATATAAGAGAAAAAGGATAGGAGGCAGGGT
AGAATTATCTCGTCAGTAATTATCATACTTTTCTTTATTCACCCTACCATAACAACGCAA
ATGTTTAATGCTTTCAATTGCCAAGACATAGATGGAACTTAAAGACTTTACGAAGATTTG
GAAGTTGTATGTTATATAGGAAATCATAAGTGGATAGCATATGGCGTAGCACTACCAGCC
ATAATCATATGGAGCATGGGAATTCCAGCATATGGCTTTGCTTTAATATATATGAAAAGA
AAAGAGCTGTTTACTATAGTAGTAAAAGAAAAATATGGTTTTCTTTACAATGGTTACAAA
GAACATTCTTTTTATTGGGAGATATTTATCATGTACAGAAAAATCACGATTATCTTTATT
TAAGTTTTTCTGGCTTAAGTGGGAAAAGTGGTATAAGCTCTAGTAATTATTGTAGTTATA
GTGCTTTGCTTAGTGGGCAACACATTCAAGCAGCCCTTTGATAACTACCACTTGAATAAT
TTAGAGACTCTCTCACTTCTCTCCTCAGCACTAACTATTTATTGCGGTATCTTTTACATA
GCAGGAGAAGACCTGTTCTACCTTTCTGAAGATGGAAAATTGTTCTTGTTTGGAATTATT
GTGGCAGTCAATGTGCTGTTCTTCCTGTATTGGTTTTTGAAGTTTAGTGATTAACTCAGG
ATTACTCTTAAGAAAAAAGCACCAAAAGTATATTTCGTTCTATTTCTCTGCTGCAACAAG
AGAAGACAAGAAAAAGAGAAAATTATAGATAATTACCTTATTAAGCACAATCATTTCTTG
AAGAGTTATGAAAATATCTGTGATTATCTGGTTGAAAACAAGAACTTGTACAAAAACGGG
TATATTCCTCCAGAAGATTAAGCACTCTAGTAAATCATTCTAAAGTTGACTCAATTTAAG
ACATAAATAGATAGAGAGAAAAATTTTTAAATGCTTAAAAATAATCCAATTGAGAAACTT
CTCATGGACAAAGAAATGAAAACTGCCATTAATCAGTATAAATTGAGGCCAAAGCAAGAA
AACGATGAGCAGATGTAGAAGATTTAGGGTTAAAAACTGTCAATAGATTTTGGTGGAAAC
GGAGAAAATGACATAGATATTAATGATGAAGAATAGAGTTCATATTATTTGGATAATTAG
CATTAAATGACTAAGAAGAAGCTTAAGGATGTCTATGATTTTGATTACTAGTCGTCATAC
GACAACGATAATCTAGAATATGAAGAAATCTAGCCCAGCTCTAGATTTAACAATCAGTTC
AAGAATTTACTATAAAACTCCAAGTAATTACCTCAAACTCAAACAAATTCAGCACTTGGT
CAGGCTACTATCTTCACAATAAACGAACTTCATGGAACTTCCTTGACTCCAGATGGGTAA
AACTATCTGTAAATACCTATTAATAAAAATGTAAAAAATTAGAAAAGAGGCAGTAAAATA
TTACTGGATATGGATCAACAGTACAGTAATAGATCGAATGTCAATAAGACAAAACCATCT
TCAGGTAGAAGAGGCACATTAGTTCAGTAGTATGCCAAAATAGCCCCGAAAGAATAATTT
GTGAAGAGTAATTCCCTCGCGCTTTCTCTTTCAATGCCAAATATCAAAGATAACATGCCC
ACTAACTATCAAATAAGCATCCTGAACTAAAACATGGTTGATGATAACAATAGTAACGAT
GTGAATGTTTTCTTACCCACCTCTAAAAACTCAATGATCACAACAGCTGATTAGAATTCG
CAATTGAAAAATTCCTATATTCATCTGTAAAACTAGCAGCCAGACAGAGATTAGTAAAGA
AAAGACTAAATCAAGAAAAACCTGCAAAATTACAATACTTTATTGGCTAGATAGATGCAC
AATTAGTCTTTGGATTATGATCAAGAAGAGATATAGGAGGGATTAGCTGGGGGCACTGTC
AAGAATAGAAAGCACAATGGGAAGTTAATAGGATCTTTGGAATATTCTCATCAAGAACAA
CAAATAACTAAAAACCCTCAAAGCTTATATCAGTAACGAGACAACAACGGAGATAAGTAT
GTTTAAGATGGTGTTGAGGATATTGATATTCTTCATTTGTCATTAGATGAAAATAGCAAC
GATAGGCTAAATATTTATTCAGGGTAAAACGAAGTAAACAATCTTTACTATGGAGGAGAA
GAAGACGATATATAGTCTAGTGAGAAAAGTTAAGACCTGATAGAAAACCTAGAGAATTTC
AGAGACGCCTTGAAAGACAGAAACGGCAGTGAAGCTTACGACATAAAGATACAAAAACGT
CCATAAGCTAAAAACGGTGGAGGAAATACAAATAATTACATGATTGGTGCTATTGGTGGA
TAATCTATGAAAGCTAATAGAAATGCCTCCTCAAAAAGTCTAAATAGGTTGGGTAGAGAA
GCTGCATCTTAGAAGCAAAGAGGGAAAATAAGAGATCATAAATTTAAGTAAAGGCAGTTG
ATGAAATCAGGCACAGAATACTCTCTCGAACACGATAAAAATGATCAGATATAGCTTGAT
GATATGATTGGTGAAGATTAAAATACTGATTTATTACAGAAGAACTAGTTCAAAGTTGAT
AGTGGTACAATTATTTAAGACGAAGAGGAATTTGATTTTGAAGGAGAATTTAATGACCAG
CTCGATATATAAAGTGATTAATTTCAAAACTTAGCTAAAAATACATCAAGACAGTAAAAT
AAACAATAATTGAGTACTCCTGATGAGTACAAATTTAACATTAAAGAAATGAGCTTGTGA


>Contig9740.0.g65(protein)
MTLALESNAQMPNTTISITCAKNEVGISPLSQTSLQATGYCYACRALLPGCRSCSSTTMG
QQTLISCDECEEGMYKYKLTKSVNAGPNQTISASINVCVPDCPSVNFQLINNPITQKCEF
LGFYCKYGDFYNGCKQCSLQDQHYIAGNTGFITTINSTLVSAASFVNGNNFQFCTQCQYT
EATVQTNQLSYFSKCQFKSKCDADLSLQMSNYCYECSLWQTPPSEYNCTKCWNQYTLNTS
SLTLKTVGGQGGGGSSKTSCTSQSSACDNTVSNCKECSSTNTTQCIFCSQGFVLYNGQCL
SVCPEKYFVEITQDDTTLLPKAASCSQCDTSCYSCIDGLSSSCTSCLNGQFLSISSVFTQ
SGTCMDKIAYTGSTKYISITSIRSASPSVVISQDEQTTSFDNIFDAVNQAYQIAAPYSGM
TIEIQMNDPTYYILKKDLLKVYYNQKFKDFINPQFNLKITSTQAAKTTIYNKIGGMFQIQ
VPLSLSIENIIIDSSDSVVAQSTNSISCNGTADTYKNYFIPYHILIYQSTFKNIGTCGAI
ISNDYLNSGVSYSGDIQMQSISIGYYLTTQNAYKDSFTNIYYNKTYTNMARQSSNIIFHT
SSFQNFHALKVLETNLTAVQDSARDHGLVLQLRDFKGNVHFESCTFKEIQQPVASAKFNV
SAADKNKYEMENYIHYVIIEDARYLQFQRLINLVDTHETSTVYLKSNSFTNLSLTNALIK
VKSLSSEYLVYTIIESNTFSNIIGLMGTGILHVEKGLYQSLSTAEQALQCGGGTHIQSNT
FSEITGTESVDIGLMFFGCKDLSKATSGQSTSMEGLNDKFGADQNSLNSNLIGLQTSMQT
LISGSTTAATISVYSGVVSDSFSTSYTINKYQTTLKYNTYYDCTLGVTILSNEHYYLGSL
IATMGVMAIQLTGENYKNIGSFTQEYFNIIASQLDLSLTGQQKEFLSNTDNKGEFFRDRH
TSFSSDQMMAVIGYFKNYVGTLNIGDTSGSTYNYFQNIVGMFNQHAIDTLSWLPGNTAYQ
YANKYYQGFCSPMFYLASNNISTLNFYNNVFQNNYAYYSDVQSTFVASIIEFDNTFKDQE
TTITFKNIKVYNNYQVYGYYYFNIEGTYITFTNVDVQNNGYHFTFLSNSYDSSYNYKYQA
QPIFLINFEAQDSSSYLKITSCTFTNNTAENTPLFQLESSNSQSQNTFADYYLVTLDSCT
FTSNIGTTSSIMLNQDSDLNFKLLFSSCTFKSNFATYGLIKVVSYLEMLDMLSCTFNTNT
GTLAKLFYFTNNLIKYIEVNQIQFKTYFTKQIRKASIYETQVDTDDIQEYLLEDLSTYYL
SSNPSLIVLSGQSNFNITDSYVKYIHYAYYGAFMTLESSSSANITNVNIKGVISAQDSSY
LTVDNTIFVDNFAVEISVFKVSATSDIYVSGSQFYSNYVTSQNSIGQFIQSKGSSIKNSV
IKSNYISSGGSSNTLQLISSTVVFEYLTFKDNQAQKNSAGIQVVLSNVYFNYSTFQNTNP
STAATKISGDFIYAISDSNIYINNTSFLNGRAKDGGAIYLLGYSNLTIENSHFNSCSVDS
SGGAIYAASFDQFLIINSHFYKNKAGIQGDAIYSSNSLGYININSSSSFYSQASSNFLYL
TSIESVNITNVTIYSSAKNESDSSKFSGIFLENIKTFRLIASTMKQLIANTTGGCLYITE
NSNNKQTANSVRYLIGNSTFVNCSALQGGAIFLSNVQGVMINDSSQFINNTAYISYLQDQ
TSYEYGVGGAINFYCQSGETKCTLSMEKVAFYQNYAQVKGGAFNWNYLEPTQKTLTFTNN
TAKIYGNSISSVPKTLSLLTATQYQQSQERFATSSDQSLLMLRRSMDSSNSLYTLSSQKS
GGNLDPLYFALLDKYSQIVATDLDSTLFLSAIQNSALQFASTFETVTSFGISNGAFEVSN
VVFVGTPNSVQTFNITTDGIDFSIPDNAAYYSTSTSTSLSQIQQSAAVAINKQLYVTISL
RDCEAGEALLSSGKCSDCAAGLYLLESPDEVVSCKECQSTVSYCYGRNEVYPRAGYWRSS
IYSDNFISCRNDVACLGMNPPENNSLGACEVGYQGILCTDCQINYSRTGTYECSLCPDAT
SNSFKLFAIFVAVICALVFLIRSTIAGALEQKNYLSVFIRILSNHFQLLIITASFDFQWP
TQLLEFFNSVKPASEATTQFLSVDCFIDTRSSNSDKGTIRAFYSKTIILALAPILVVIMC
FVIWVIIFKIQDYKQKNKKDEITVKLEEFREQNELQRKNTIALHRFNTNQDIKNLGVNSS
KEKLVSTSRSKGNISTQKQLKISHSDDVDEVHFDSKSHSGKTQKTSKPLYQLNNYTTTPR
QNPNQIQTDGSDNQNHHLLTENEEEMLAQLIQEKKDRRQGRIISSVIIILFFIHPTITTQ
MFNAFNCQDIDGTQRLYEDLEVVCYIGNHKWIAYGVALPAIIIWSMGIPAYGFALIYMKR
KELFTIVVKEKYGFLYNGYKEHSFYWEIFIMYRKITIIFIQVFLAQVGKVVQALVIIVVI
VLCLVGNTFKQPFDNYHLNNLETLSLLSSALTIYCGIFYIAGEDLFYLSEDGKLFLFGII
VAVNVLFFLYWFLKFSDQLRITLKKKAPKVYFVLFLCCNKRRQEKEKIIDNYLIKHNHFL
KSYENICDYLVENKNLYKNGYIPPEDQALQQIILKLTQFKTQIDREKNFQMLKNNPIEKL
LMDKEMKTAINQYKLRPKQENDEQMQKIQGQKLSIDFGGNGENDIDINDEEQSSYYLDNQ
HQMTKKKLKDVYDFDYQSSYDNDNLEYEEIQPSSRFNNQFKNLLQNSKQLPQTQTNSALG
QATIFTINELHGTSLTPDGQNYLQIPINKNVKNQKRGSKILLDMDQQYSNRSNVNKTKPS
SGRRGTLVQQYAKIAPKEQFVKSNSLALSLSMPNIKDNMPTNYQISILNQNMVDDNNSND
VNVFLPTSKNSMITTADQNSQLKNSYIHLQNQQPDRDQQRKDQIKKNLQNYNTLLARQMH
NQSLDYDQEEIQEGLAGGTVKNRKHNGKLIGSLEYSHQEQQITKNPQSLYQQRDNNGDKY
VQDGVEDIDILHLSLDENSNDRLNIYSGQNEVNNLYYGGEEDDIQSSEKSQDLIENLENF
RDALKDRNGSEAYDIKIQKRPQAKNGGGNTNNYMIGAIGGQSMKANRNASSKSLNRLGRE
AASQKQRGKIRDHKFKQRQLMKSGTEYSLEHDKNDQIQLDDMIGEDQNTDLLQKNQFKVD
SGTIIQDEEEFDFEGEFNDQLDIQSDQFQNLAKNTSRQQNKQQLSTPDEYKFNIKEMSL