Identifiers and Description

Gene Model Identifier

Contig9717.0.g94

Standard Name

None

Aliases

Contig9717_0_g94

Description

Cullin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00888 ) Cullin family
  • ( pfam08672 ) Anaphase promoting complex (APC) subunit 2
  • ( pfam00452 ) Apoptosis regulator proteins, Bcl-2 family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008251201.000499495426459e-47hypothetical protein
SGDYLR127C0.000000000000006999063783600386APC2 SGDID:S000004117, Chr XII
from 398319-395758, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9717.0.g94(coding)
ATGGAAAGAACAAGGTAAATGTCTGAGTTTCAGACTTTTGGAGTTCCTGCTTCAGAAATT
GTAAATCAAACCCTTAAAAAATTAGGTGACTTAAACACTATCCTTTCTAAGAGCAGATTA
AGGCTTAAGTTTGATGCTTTATTCAAGCAAGCCATAAAGGGGGAAAACTTTGACTTCAAT
TTATTATAATCTCTGTTGGTAGAGGTAAGCAGCTTCAGACTTGATCAATATGAGTTCATT
AGAGGAGTCACAAGAAATTTTATAGACGAGTTTAACAACTATTCAAAAACTGTCTACTCC
AAACACATTGATTAACAGCTAAGTGGTATAGATTATTAATCTGAGGAAGATGAAGTAATA
CAATAGAATATTACTCAAATTTTTACTAATTTTGAAAAGTTATTCAAAATATTCTCAACA
TGCATTAAGATAATATAAATGATTGAAAATGGCTTCCCTCAGCTTTAAAACTTATAATTG
GAGCTTTATGATGCTTATAGATATGGCTTAATAGGCAGTTCTAAGACTGATTTAAAGAAA
ATTGCAAGATACTTCTTTATGTATGGTTTCTAGGAATTTGAAAACCTTTGCTCATAAAAG
ATTGCCGCTTTTTTCCAAAGAGATCCTGAAGATTCTTCTGAAATACCAATTATTCATATT
GAAGGGGATGTAGCTGATATAATATTTGGAGAAAGTCAAGGAAATCTTCCCTAGCAGTAC
AATTCTCTATTAGGTTAAATGTAAGCATTTACTCAAATACTCATTACTATTGGATGGCCT
GAATTTATTGACAATTCCTATGAGAAAATTCTTTAACTACAAGTTGAAAAGTATTTAGAC
CAAATCAAAGGAGTATTCGCTTAACCGACTTTAAAAATTATCCAATCTTATCTAGAGAGT
GTCACTTAAAAGTGGATACAAGCTGTTTTAAACTTGAATAACTATGATAATTTGCAAATT
CAAGATTAAAAGAGAAAGATCTAAACTAAATGGAAATGCGACCTTGAGAAGCATTTGCTA
AGTCAGTATGTCAACCAAAGAACAAAAGATATGTTTTAGATTTTCCAAGAGTTTCCTGAT
TCACTTCCAGCTATCAACGATTTTAAGTATGCTCTTGACAAGACAAAGTTGCATAAGTTC
TTTGCCAACTAAATTAAAGAATAGTTCTCACAAAGACTTCTCTTACCAGGTGTGATTACT
TTCATGATTATTGAGCATTACATTTAAGCAATTAGAGTAATAAAACTCATTGATCCTTCT
ACAATTCTTCTTGAAATCATCTCAGAGCCAATCAAGGATCACTTGAGATAGAGATAAGAT
ACACTCAGATGTATTGTTCAAAGTATTCTTGCTGATGAATCTGAACTTTATGATCAGCTA
GGATAAGCTTATGTTAGAATTCCACTAAGAGGTAACAAGAAGAGATAAAACGATTACAAG
TCCTCAGACCCTACAAAGTCTCATCATGACGACGATGACGACTATATAAGTTCAGATGAA
GATGAGCATGCTGCTGAGAATTGGGAACCTCTGCCTATTTAAAATGATATGAAGGACTTC
TTCATTTCTGCAAAAAGAAAGAAGACTGATATCATATCTACATTAGTGAATATCTATGGT
TCTTAAGATGCATTCCTAAAAGTTTACAAGTCCATGCTTGAAGAAAGACTTCTCTCCGGA
AATGAAGTTAAACAAGAAAATGAAATTAAAAACTTGGAGCTCATGAAACTCAGATTTGGA
GATCAAAACCTCCATGCTTGTGATGTTATGCTTAGAGATATCAAAGAATCTGAAAGAATC
AGAACCGCTATTAGAAAAGCTCTAGAACAAAAGTAAGCTCAGAAATAATAAGCAATATCT
GGTTCAAAAGAACTACCCTTAAACAGTTTTAATGCTTGTATTATTTCAAAGGGATATTGG
GATTAAGTTTTGGATGATGATACTTCAAATGTATATTAGCCTCCAGCTTTCTTAAAGAAA
ACTTACGAAGACTTTTCACAGTACTACTAATCTTTCAAGAGAATTAGGACTGTAAATTTT
AGACCTTAACTAGGATCTGTAAACTTGACTCTTCACTTTGATAATGGATCTTTCAAGTTT
AGAGTAACACCAATTCAAGCAGCAATTATAACAATGTTTGATGATGAAAATTCAAAGAAT
TTATCAGCTGAGTATATTGCGAAGGAACTTGATATTGCAGTTGATGATTTGAGAAGAAAG
ATTGCTTTCTGGGTTTGCAAAGGAGTCTTGAAAGAGAAGAAAGTTTTCAAGTAAATTGGA
ACTTCGCACTATAGATCAACTGCTTTGTTAAGCAATCAAGATGTTGAGATTGTGTACTCA
TCAGTGGATACATTGGAGTTGAAGGGGGATTAATCGAGTTCCGATAGATTGATTGAAGCA
AATGAACTCATTGACTATGGTGCTCAAGATTAGATCATCAAGATCCAGCAGATTTAGAGT
TAAGATGATGAAAAACTTGTCAGAAGTTTTGTTATCAATATCATTAACAACTCTAACTAA
ACTGGAGGATGCAACTTCGATAAGATTTTCAGTATGTTGAAGAATGTCTACATGGTAGGA
CAGCACATCTAAAAAGCTGGCCTAGAAGAACTTTTACAGAAGATCATTAACGAACAAAAA
ATCTCATTCAATCTATTTTGA


>Contig9717.0.g94(protein)
MERTRQMSEFQTFGVPASEIVNQTLKKLGDLNTILSKSRLRLKFDALFKQAIKGENFDFN
LLQSLLVEVSSFRLDQYEFIRGVTRNFIDEFNNYSKTVYSKHIDQQLSGIDYQSEEDEVI
QQNITQIFTNFEKLFKIFSTCIKIIQMIENGFPQLQNLQLELYDAYRYGLIGSSKTDLKK
IARYFFMYGFQEFENLCSQKIAAFFQRDPEDSSEIPIIHIEGDVADIIFGESQGNLPQQY
NSLLGQMQAFTQILITIGWPEFIDNSYEKILQLQVEKYLDQIKGVFAQPTLKIIQSYLES
VTQKWIQAVLNLNNYDNLQIQDQKRKIQTKWKCDLEKHLLSQYVNQRTKDMFQIFQEFPD
SLPAINDFKYALDKTKLHKFFANQIKEQFSQRLLLPGVITFMIIEHYIQAIRVIKLIDPS
TILLEIISEPIKDHLRQRQDTLRCIVQSILADESELYDQLGQAYVRIPLRGNKKRQNDYK
SSDPTKSHHDDDDDYISSDEDEHAAENWEPLPIQNDMKDFFISAKRKKTDIISTLVNIYG
SQDAFLKVYKSMLEERLLSGNEVKQENEIKNLELMKLRFGDQNLHACDVMLRDIKESERI
RTAIRKALEQKQAQKQQAISGSKELPLNSFNACIISKGYWDQVLDDDTSNVYQPPAFLKK
TYEDFSQYYQSFKRIRTVNFRPQLGSVNLTLHFDNGSFKFRVTPIQAAIITMFDDENSKN
LSAEYIAKELDIAVDDLRRKIAFWVCKGVLKEKKVFKQIGTSHYRSTALLSNQDVEIVYS
SVDTLELKGDQSSSDRLIEANELIDYGAQDQIIKIQQIQSQDDEKLVRSFVINIINNSNQ
TGGCNFDKIFSMLKNVYMVGQHIQKAGLEELLQKIINEQKISFNLF