Identifiers and Description

Gene Model Identifier

Contig9574.0.0.g63

Standard Name

None

Aliases

Contig9574_0_0_g63

Description

Putative esterase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00756 ) Putative esterase
  • ( pfam08240 ) Alcohol dehydrogenase GroES-like domain
  • ( pfam00107 ) Zinc-binding dehydrogenase
  • ( pfam02230 ) Phospholipase/Carboxylesterase
  • ( pfam01262 ) Alanine dehydrogenase/PNT, C-terminal domain
  • ( pfam02826 ) D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
  • ( pfam00326 ) Prolyl oligopeptidase family
  • ( pfam10503 ) Esterase PHB depolymerase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002957009.997093137033517e-262alcohol dehydrogenase family p
rotein
SGDYDL168W3.999155465305724e-142SFA1 SGDID:S000002327, Chr IV
from 159604-160764, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9574.0.0.g63(coding)
ATGGAAAGTCAAGGTACTCAAGGCCAAGTCATTAGATGCAAAGCTGCAGTTGCATGGGAA
GCAAATAAACCATTAGATATCTGCGAGATTGAAGTTGCTCCACCCCAAAAAGGTGAAATC
AGAGTGAGAGTTGTTGCTAATGCACTATGTCACACAGATATATATACTTTAGATGGTCAT
GATCCAGAAGGATTGTTCCCATGTATTCTTGGACACGAAGCTACAGCTATTGTCGAGAGT
ATTGGTGAAGGAGTTACTTCAGTCAAAGTTGGAGATACTGTTATCCCTTGCTATACTCCT
CAATGTATGGAGAGAGATTGTGTCTTCTGCATGAGTTAAAAGACAAATCTTTGCCCCAAG
ATCCGTGCTACTCAAGGAAAAGGAGTGATGCCAGATGGAACAACCAGATTCTCAAAGGAT
GGAAAACCCATTTATCATTTTATGGGATGCTCTACTTTCAGTGAATACACAGTTATTGCT
GAAATCTCAGCTGCTAAAATCAATCCAACTGCCGATCTTAACAAGGTTTGCATGCTAGGT
TGTGGAGTTAGCACTGGATGGGGAGCTGCAATGGTAAACCCAGAAGTTAAACCAGGCACA
ACTGTTGCTGTTTGGGGTTTAGGAGCTGTAGGTCTTGCTGTAATCTAAGCTGCTAAGCTT
CAAGGTGCTGGAAAAATCTATGGATTTGATGTTAATCATGATAAATTTGATCACGCAAAG
AAGCTAGGTGCCGATGAGTGCTTTAACCCTATGGAATCAGATTCTAAGGATTGGTTACTC
TAAAGAGAAAAGTGGGGTGTTCATTATACCTACGATTGCACAGGAAATGTTGCTGTCATG
AGAACTGCTCTAGAAGCTGCTCATAGAGGATATGGGGAAAGCTGTATCATTGGTGTTGCT
GCTGCAGGTAAAGAAATCTCAACTAGACCTTTCTAACTTGTTACTGGAAGATAGTGGAAA
GGAACAGCATTCGGAGGATGGAAGAGTAGAGAAGATGTCCCAAAGCTTGTCAATAAAGTT
GTTGTAGGAGAATTGAATGTTGATGATTTCATTACTCATTATTTCGATGGTCTTGACTAA
GTAAACGAATCAATTGATATCCTTCACTCTGGCAAATGTCTAAGAGCTGTAGTCAAAATC
TCATCAACAGATGTTTAAGAGTCTCATAATGTCAAAGTTTTGTAAAGCTAGAAATATCAA
GGAGGTGTACTAAAGACTGTACAACATTGGAGTAATGTAAACAACTGTGAAATGAAATTC
ATGATTTTCCTTCCAAATGAAACAATTAAAGAACAAAGAGGTAAGGCATACCCAGCTCTA
TATTTCTTATCTGGACTTACTGCAACTCACGAAAATGCAGCAATCAAGAGTCACTTTGGT
GCATTTGCCAAGAAACACAATATTGCTATGATTTTCCCAGATACCTCCCCAAGAGGTGTT
GAAATTGAAGGCATAAAAGAAAATTGGTGGTTTGGTGAGAGTGCTGGCTACTATTTAAAT
GCTACTGAAGGAAAATGGTCAAAGAACTTCAATATGTATAGCTATATTAATGAGGAGTTA
CCTTAAGTTGTTGAAAGACACTTCCATGTTGATGGATCCAGAAAATCAATTACTGGTTTG
AGTATGGGAGGAATGGGTGCTCTTCAAATCTACTTGAAGAATTCAGAAAAATATAGATCA
GTTTCTGCTTTCAGCCCTATCGCTAACCCTAGTGAGTGTTAATGGGGGACTTCTAAGGCC
GCAAGACACCAATTCTCATTGATTAAGGTTCTCACGATAAATTCTTGA


>Contig9574.0.0.g63(protein)
MESQGTQGQVIRCKAAVAWEANKPLDICEIEVAPPQKGEIRVRVVANALCHTDIYTLDGH
DPEGLFPCILGHEATAIVESIGEGVTSVKVGDTVIPCYTPQCMERDCVFCMSQKTNLCPK
IRATQGKGVMPDGTTRFSKDGKPIYHFMGCSTFSEYTVIAEISAAKINPTADLNKVCMLG
CGVSTGWGAAMVNPEVKPGTTVAVWGLGAVGLAVIQAAKLQGAGKIYGFDVNHDKFDHAK
KLGADECFNPMESDSKDWLLQREKWGVHYTYDCTGNVAVMRTALEAAHRGYGESCIIGVA
AAGKEISTRPFQLVTGRQWKGTAFGGWKSREDVPKLVNKVVVGELNVDDFITHYFDGLDQ
VNESIDILHSGKCLRAVVKISSTDVQESHNVKVLQSQKYQGGVLKTVQHWSNVNNCEMKF
MIFLPNETIKEQRGKAYPALYFLSGLTATHENAAIKSHFGAFAKKHNIAMIFPDTSPRGV
EIEGIKENWWFGESAGYYLNATEGKWSKNFNMYSYINEELPQVVERHFHVDGSRKSITGL
SMGGMGALQIYLKNSEKYRSVSAFSPIANPSECQWGTSKAARHQFSLIKVLTINS