Identifiers and Description

Gene Model Identifier

Contig9505.0.g59

Standard Name

None

Aliases

Contig9505_0_g59

Description

Fatty acid desaturase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004442607.998842802738429e-74Fatty acid desaturase family p
rotein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9505.0.g59(coding)
ATGAAAGAAATCCAGAAGGATGCCTAAGATCTTAAAGAGGCTTCTCAAGTGACTAAAACT
TCTCAAGTATTAAATGAAAGGCAGCAAGATATAAGCTACTCAAAGAGCGCTAGATCTACA
CTTTTGGATTAGAAAGCTGTGAGTGAAGCTAAAAATCAGGATACAAGACCTTCTGGTTGG
TCAGATATCTTGCCGTACTTCCTTCCATTTGTAGTCTTTGCCTTCATGGCCTACTCAGAG
TTTAAATATGGCAATCCTTTCGTAATTGTTTGGCTAGCATATGTCGTGATCCCTATATGC
GATTACTTGCTCCCTGTTGATCACAAAAACCTTTCAGAAGTTCAAGTAAGAGCTTTTGAA
AAGGACAAAAGATTTTTGATCCCAGTTTATCTTACATGGCTTCTTGACGTATGCATTTAT
TTCTCAATTCTCTACTTTGTGAGTATTGGGAAAATTGCTTAAACTCCAGCTTCATTTGTG
CTCTATGTCGTATCTTATGCTCAACCAGGAGCAATTAATGCTGTAGTAGGCCATGAACTT
TTGCATAGAAGAGAAAAGGTTCATAAAATCTTTGGTACTTTAGCCTATTCAAAGATGCTT
TACTCTCATTTCTTGGTTCAACACATAGTCTCACATCACAAAAAAGTAGCGACTCCTGAT
GACCCATCTACTGCAAGAATGAATGAATCTCTATATGATTTTTATTGGAGAGCTCTACCA
GACAGCTATGTTGAAGTTTGGAATATTGAAAAGTAAAGATTAGAAAGAGAGAATGTTTCC
CCCTTTAACCCAATCAGAAATAGACTTCTGTTATTCAACTTTGGTCATTTAGTCTGGCTT
GGTATAGTTTATCAATTCTTCGGAGCTTACACAGTTGTGTTCCATCTAGCCTATTCATTA
ATTACTACTATGATGCTTGAGGCAGTTAATTATTTAGAACACTACGGTCTATTGAGAAAG
AAGGACGCAAATGGCAACTATGAATCAGTCAGTATAAAGCATTCATTTAATGCACCTCAA
GTAGTAACAAACTTAATCCTTTTCAAACTTCAGAGACACTCTGATCATCACGCTTACGCA
TACAAGCCATACCAAATTCTTGATAGTTACCCAGAAAGCCCTATGCTTCCTTATGGCTAT
TCGATTTCATTGGTTTTATCATTCTTCCCTTACATTTGGAAAAAGGTTCACAATCCTATC
GCAGAGGCTACAAATAACGATACTAAGATATCTGAAGAAGTTAGACAAGATATGGAAAAG
TGGATTTTAGGCACTCTTATTGGTGTTTCTATAGTGCTCACTTACATAACATTCTTTGTT
ATTGGATTTACTCCTAGAGAATGA


>Contig9505.0.g59(protein)
MKEIQKDAQDLKEASQVTKTSQVLNERQQDISYSKSARSTLLDQKAVSEAKNQDTRPSGW
SDILPYFLPFVVFAFMAYSEFKYGNPFVIVWLAYVVIPICDYLLPVDHKNLSEVQVRAFE
KDKRFLIPVYLTWLLDVCIYFSILYFVSIGKIAQTPASFVLYVVSYAQPGAINAVVGHEL
LHRREKVHKIFGTLAYSKMLYSHFLVQHIVSHHKKVATPDDPSTARMNESLYDFYWRALP
DSYVEVWNIEKQRLERENVSPFNPIRNRLLLFNFGHLVWLGIVYQFFGAYTVVFHLAYSL
ITTMMLEAVNYLEHYGLLRKKDANGNYESVSIKHSFNAPQVVTNLILFKLQRHSDHHAYA
YKPYQILDSYPESPMLPYGYSISLVLSFFPYIWKKVHNPIAEATNNDTKISEEVRQDMEK
WILGTLIGVSIVLTYITFFVIGFTPRE