Identifiers and Description

Gene Model Identifier

Contig9219.0.g29

Standard Name

None

Aliases

Contig9219_0_g29

Description

von Willebrand factor type A domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13768 ) von Willebrand factor type A domain
  • ( pfam08487 ) Vault protein inter-alpha-trypsin domain
  • ( pfam00092 ) von Willebrand factor type A domain
  • ( pfam13519 ) von Willebrand factor type A domain
  • ( pfam13757 ) Vault protein inter-alpha-trypsin domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008092401.999002769139511e-37von Willebrand factor type A d
omain containin...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9219.0.g29(coding)
ATGAAAAACTAAGCTACAAACATTGCAGATTTCTCTATGGAAGATGTAATAGAGGATAAA
GCTGATGGCGAAGTTTAGGAACATATTCAGCAATCAACTCAATAGTGTACTATGATGCAG
GTCTAAGATTCATATAGTAAAGATAATGATAAAATTGAATAACTCTAATCACATCAGGAA
AATTAAGAGAAAAGCTTTATGCAACAAAATTTAAAAGAACGTACATTTAAAGAAAACAAT
TTGCAAGAAATGAATATCTAATAAGATAAGTCAACTCAATAGGAAGATGTTAAGGGTATT
AGTAATGAAGAACATAATGATAAGTAAAGATTTAATGATAAACAGTTAGGGAATCCACAA
TATTATAACTAAAGTGAATTGAACGCGATATTCCCAGCAGAAAGATAGAGGATTTGCTGT
AGATGTGGCTTTTATTATGACAATTAACGCTACAGTTTTAACATTAAGAATCAATAGTAA
ACTCTGCATTTTGAATCACAACATCTCGAGGCGACAGTTTAAAATTCTATCGCAACTATA
AGGTTGACTTAAGTATTCATTAATGAACTAGATGAGGCAGTTGAAGCAACATATTCCTTC
CCAACAGACCCTGACATCATAGTGAGCAAATTATAAATAGAGCTAGGTGACAGGATTGTA
GAAGGTAAAATCATGGAGAAACAACAAGCAAGGGAAAAATACGATGATGCCATAGCAGGT
GGCAACGCAGCTGTTCTTGTTTAGGAGAAGGAGAAAAACAAGGACTTATTAGAAATGACT
ATTGGAGGTATCAACCCAGATTAATAAGTCAAAGTGACTCTGGAATTTATCAAGCAACTT
GAAATTGAAGGAGGAGCTTATTGCCTTAGAATGCCAACTAGTTACTTCATTAAGACATAT
GGAGAGGTATCTGAGAATGGTGTAAAAATTAAAAACAATCACAATTTTGATGGAAGAAAA
AACCGTGAACCAACAGCTCAGTATACACTTAGATTGTTGATAAATGCACTTCAGCCAATA
ACTTACTTAAGCATACCAAATTAGTCAAAATTAAAAAGTTCTAATCACAAATTGCCAACT
ATAGTAGAAATCGAAGAGCTAGAAGGTAACGCTTATGCAATGAAAAAAGACTTGCTTCTT
TATTTCCGTACTACGCAAATGGGAAAACCTTTGTTGCTCGCCTAGTAAAGCCCTAAACAC
CCTGACGAAGTGGCTTGTCTAGTGAGTTTAGTACCAACATTTTCACCACCTAATCCTCAA
GAAGAAATTGAAATTTTAGAAAATGAGAGACCCGAGGAATAAGATATCATTGATATGAAA
TCTACAGATACATCAAAGCAAGCTTATATTTTCATAGTAGATAGAAGTGGATCAATGAGA
GGAGAGAAAATGGACATGACTAAGGAGGCATTAAAGTTATTTGTTTCTAGTTTACCACCA
GACTGTTTGTTTGAAATAATCAGTTTTGGCGAAGAATTTTCTACTACCAGTCCTAACGGA
GATGGTTTTCACAACAATGATTGGGAAATTGTTGAAGTAAAATCTAAAATTGATAAATTC
ATTGCAAACATGCGTGGTACAAATATGTACCCCCCTTTGAACTATGCACTTAATGCTATA
TTCGATATAGTCAGTGAACCCGAAGACCCTATTCAGAAAAAAATATTTTTGCTAACTGAT
GGGTATGATGGGTACATTGGATCACGTAGAGTTCCACATAATCAGATGATTGAGTTTGAT
AGTGTAATAGATAAGATAAGAAAAAGAGACCATGACTGTGCAGTGCATACATTCGGTATT
GGTAATGATTACAATAAACAGCTAGTTAAGGGCTTTGCAAAAGCAGGACGAGGAAGCTAC
TCATTCGTAGAAGATATAGATAACCTAAAAGGTAAGATCATCAAAGCACTTTAAAAAGCC
ATTGAACCCTCATTGTAGGGTTGTAGATTTGAATTTCCGATGGAATGCGATATTTAGTGT
CCAAGAGAAGGTCTAATTGGAGAAGCCTTCAGAAACGAAATAACAAATTTATACTTAGTC
ATGAAGAAAAGCGTCTTTGAGAATTTCAAGATGTCTTACCATGTTCAAAATGATCCTATT
TAAAACTGTTCTCTCTTCCAAGAGTACAATTAGGATGAATTTAAAATGCTAGAGGATGGA
GAGACTTTATTTAAATTAGCTGCAAAAATGATGATAAAAGAACTTGACGATAGTTATACC
AGAAACATTGGAAATAAGTTTAAAAAAGAAATTAAAGCTTAATAGTAAATGTTATCAATA
AAATACCAAGTATTATGTGAGAAAACAGCTTTTGTTGGAGTAGTGAAGCAAGATAATAAA
CATACTGGAGAACTCAAGCATGTTATGATATCTACCATTTCATCTGTTGATAAAAGAAGC
CATTACTAGAATTAGAACAATCAACAGAATTCTAGTTATATGCCTTAATCTACTGCAGGT
TAATCTCAACAGTATTAAGGCAATACACGCGCAGCATATAACAAGCCAACTCGCTTATAT
GGTTAACTCAAAGCTGCTAACAATTCAAATATGTCAATGCCTGCCATGAATTAAATGAAT
TATGGAGTTTATCAATCTTCTTAGCAACATTAATATTCAAGGCGTGAGTTATCTCCACAA
TACAGTGGTTCAGCAAGTTATGCAACTAGTGAAACGTTGTAGATAGAATTGCAACAAGTT
GATCATGAATTAATTATGGTAAAGCAACTTCTAGAAAATGTCAATTAATAGTTGAAAATA
CTCAAGAAAAAAGAAATGGAAAATACGGTAGGACATATATATATTAATGAAGAGAAAAAC
AAACAAGAATCAATTTCTGTGTCTATATAATTGAAGAATTAAGACCAAGTGTAGGAAGTC
AAATTGGAGGAGTAAAGATTGTAAAATAGTTAAGCATAGATGAATCCGCTTGATGCTTAT
ATGTCTACAAAGCCATTAACAATCAAATTGAAACCCACCCTTGAAACCCTGATTGATGCT
CAGTCGAGTGCTGGCATTTGGACAGATGGCAGGACTTTGTCTGTGTTTTTGGCTTCAGCT
GATTTGAATTTGGATAAGCCAAGCAATGAGGAAGTGGAGAAGGCCATGAAGGAAATGCTT
AATGAAAGCGGAAAGCAAAACATAAAGCAGGTGTGGCTCACCATACTCGCACTCTTCATC
CTCAGGGAGAAGTTTGATCACCAAGAAGACGAGTGGTCGATGATAGCAAAGAAAGCTAAG
AATTATTTAAAAAGTCAAGGAATTACAAAAATTGAGTCTCTTTTAAAGCTTATTAATTTA
CAGCTTTTGTGA


>Contig9219.0.g29(protein)
MKNQATNIADFSMEDVIEDKADGEVQEHIQQSTQQCTMMQVQDSYSKDNDKIEQLQSHQE
NQEKSFMQQNLKERTFKENNLQEMNIQQDKSTQQEDVKGISNEEHNDKQRFNDKQLGNPQ
YYNQSELNAIFPAERQRICCRCGFYYDNQRYSFNIKNQQQTLHFESQHLEATVQNSIATI
RLTQVFINELDEAVEATYSFPTDPDIIVSKLQIELGDRIVEGKIMEKQQAREKYDDAIAG
GNAAVLVQEKEKNKDLLEMTIGGINPDQQVKVTLEFIKQLEIEGGAYCLRMPTSYFIKTY
GEVSENGVKIKNNHNFDGRKNREPTAQYTLRLLINALQPITYLSIPNQSKLKSSNHKLPT
IVEIEELEGNAYAMKKDLLLYFRTTQMGKPLLLAQQSPKHPDEVACLVSLVPTFSPPNPQ
EEIEILENERPEEQDIIDMKSTDTSKQAYIFIVDRSGSMRGEKMDMTKEALKLFVSSLPP
DCLFEIISFGEEFSTTSPNGDGFHNNDWEIVEVKSKIDKFIANMRGTNMYPPLNYALNAI
FDIVSEPEDPIQKKIFLLTDGYDGYIGSRRVPHNQMIEFDSVIDKIRKRDHDCAVHTFGI
GNDYNKQLVKGFAKAGRGSYSFVEDIDNLKGKIIKALQKAIEPSLQGCRFEFPMECDIQC
PREGLIGEAFRNEITNLYLVMKKSVFENFKMSYHVQNDPIQNCSLFQEYNQDEFKMLEDG
ETLFKLAAKMMIKELDDSYTRNIGNKFKKEIKAQQQMLSIKYQVLCEKTAFVGVVKQDNK
HTGELKHVMISTISSVDKRSHYQNQNNQQNSSYMPQSTAGQSQQYQGNTRAAYNKPTRLY
GQLKAANNSNMSMPAMNQMNYGVYQSSQQHQYSRRELSPQYSGSASYATSETLQIELQQV
DHELIMVKQLLENVNQQLKILKKKEMENTVGHIYINEEKNKQESISVSIQLKNQDQVQEV
KLEEQRLQNSQAQMNPLDAYMSTKPLTIKLKPTLETLIDAQSSAGIWTDGRTLSVFLASA
DLNLDKPSNEEVEKAMKEMLNESGKQNIKQVWLTILALFILREKFDHQEDEWSMIAKKAK
NYLKSQGITKIESLLKLINLQLL