Identifiers and Description

Gene Model Identifier

Contig9150.0.g64

Standard Name

None

Aliases

Contig9150_0_g64

Description

ALG6, ALG8 glycosyltransferase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • transferase activity, transferring hexosyl groups (IEA) | GO:0016758

Domains

  • ( pfam03155 ) ALG6, ALG8 glycosyltransferase family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR067C8.997017754360629e-34ALG8 SGDID:S000005593, Chr XV
from 453462-451729, Genom...
T. thermophilaTTHERM_005008102.0004286606204839e-16ALG6, ALG8 glycosyltransferase
family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9150.0.g64(coding)
ATGGATAATAAGGTATAAAAATCTTTCGAAAAGTAATAACACCTCAAGAAGCAATTACCT
TCTAAACTTGAGTAACAGACAACTACTCAATTGAAAACCTACGCTTTTGATATTTGGCTT
ATAGTTACCTGCTTAAAACTATTGTTATTCCACTCCTACAAATCAACTGACTTTGAGGTT
CACAGAAATTGGATGGCAATAACTTATGAGAAACCCCTATCGGAATGGTACTTTGAGGCT
ACTTCAGAGTGGACGCTTGACTATCCACCTTTTTTCGCCTATTTTGAGTGGATTTTAGCA
TAAGTTGCAGTTATCTTTGATCCAGAGATGGTAAAAGTGAAAAATTTATACTATGATAGT
TTAGCAACAATTTACTATCAACGTGCAACTGTGATAGTGAGTGACTTAATCTTCTTCTAT
GCTTGTTATAGATATTTTAAGAGCAAATCAACAAACGGATAGATAAAATTTGACACTAAA
TACTTTGCTTTCAATTATTTAAATGCTGGCTTGATAATCCTTGATAACATACATTTTCAG
TATAATTCGATGATTTTCGGTCCATTTATCTACACAGGTTAATTGAAGCAAATAGTGCTG
AGATTATTTCCATTTTCAAGAGGATTAGTACACTTCTACTGGGCTTCCAATATGTGGGCT
GGCTTCATGTTTTATAATAAATATATGGTTAATATCTTGAAAATGATTCAAACTGGTACT
AAAATCCCTATTGAATATGTAGTAGAGGATATAGAAATGTTCAAGAAAATTAGTCTTGGG
TTAACACTAGTATTTTTAGTGCCTCTAATTATTGCAATGCTTATGAAATTGAACAGGAAA
AACTTTAATTTTTACTTAGCTATGACAAACTTCATTGTTTACAACTTTGGTTTTCATGTA
CATGAAAAAGCTATATTAATGACTATAATACCCTTGATGTGA


>Contig9150.0.g64(protein)
MDNKVQKSFEKQQHLKKQLPSKLEQQTTTQLKTYAFDIWLIVTCLKLLLFHSYKSTDFEV
HRNWMAITYEKPLSEWYFEATSEWTLDYPPFFAYFEWILAQVAVIFDPEMVKVKNLYYDS
LATIYYQRATVIVSDLIFFYACYRYFKSKSTNGQIKFDTKYFAFNYLNAGLIILDNIHFQ
YNSMIFGPFIYTGQLKQIVLRLFPFSRGLVHFYWASNMWAGFMFYNKYMVNILKMIQTGT
KIPIEYVVEDIEMFKKISLGLTLVFLVPLIIAMLMKLNRKNFNFYLAMTNFIVYNFGFHV
HEKAILMTIIPLM