Identifiers and Description

Gene Model Identifier

Contig9079.0.0.g83

Standard Name

None

Aliases

Contig9079_0_0_g83

Description

Dehydrogenase E1 component

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • thiamine pyrophosphate binding (IEA) | GO:0030976
  • oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor (IEA) | GO:0016624
  • catalytic activity (IEA) | GO:0003824

Biological Process

Domains

  • ( pfam00676 ) Dehydrogenase E1 component
  • ( pfam02775 ) Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
  • ( pfam13292 ) 1-deoxy-D-xylulose-5-phosphate synthase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001932301.0002534232488231e-144pyruvate dehydrogenase E1 comp
onent
SGDYER178W4.000646128913442e-117PDA1 SGDID:S000000980, Chr V f
rom 546817-548079, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9079.0.0.g83(coding)
ATGAAATCTTTGGCCAAGAAGGTGACTTAAGTCCACCCAATATTCGGTTCTCGCTCTTTC
GCTTCAACTGTGACAGTGAACATCCCCAAGTTTGAATTGCATAGACTTGATCAAAGTGAG
ATGCCAACTCAAGCAACCACTAACAAGGACGAGCTCATGACTTACTTCAAGCACATGTCA
GTGATGAGAAGAACTGAAGTTGTGGCTGATAACCTTTACAAGGCCAAACTTATCAGAGGT
TTCTGCCATTTGTACGATGGTCAAGAGGCTATTGCTGAGGGTATGGAAGCAGCACTCACC
TATGAGGATGCCATCATCACTGCTTACAGAGATCACTGTCAAGCTCTTGCCAGAGGCGAC
ACCCCATACAGAGTATTGGCTGAAATGCTTCAAAAGAAAACTGGATCATCCTCAGGTAAA
GGTGGTTCCATGCATTACTATAACTCAAAGAACAATTTCTATGGAGGTAACGGTATCGTT
GGTGCTCAACTTCCAGTTGGAACTGGTCTTGCTTTCGCCCTTAAGTACCAAAACAAGCCA
AACGTTGCTGTTGCTATGTATGGTGATGGTGCTGCCAATCAAGGTCAAATATATGAAGCT
GCAAATATGGCTGCTCTCTGGAAACTCCCAATTCTATATGTTTGTGAAAACAATCTTTAT
GGCATGGGTACTTCAAACGACAGAGCTTCCCACAACACTAAGTTCTACACCAGAGGAGAC
TTGATCCCAGGTTTCAAGATCGACGGTCAAAACATCTTAGTAGTAAGAGAAGCCATGAGA
TTCGCCAAGAAATGGTGTGTTGCTGGCAAGGGTCCCCTCTTCATCGAATTCCTTACTTAC
AGATATCACGGTCACTCCATGTCAGATCCAGGTATCACCTACAGAACCAGAGAGGAGATC
AATGAAGTGAGAGCTAAGAGAGATCCAATTGAAATCGTCAGAAAACTCTTGCTAGAAAAC
AGCTGGGCTGCTGAGGCTGAGTTGAAGGATATTGAGAAGAAGATTAGAGCTGACATCGAA
GCTGATGTTGAAAAGATGAAGTCAGATCCAGAGCCAACCTTCGAGGACTTGTACGCACAT
GTTGGTACTGACAAGCACTATATCAGAGGTGTTGAATACAAACTCAGCTAACTCGAATAC
TGA


>Contig9079.0.0.g83(protein)
MKSLAKKVTQVHPIFGSRSFASTVTVNIPKFELHRLDQSEMPTQATTNKDELMTYFKHMS
VMRRTEVVADNLYKAKLIRGFCHLYDGQEAIAEGMEAALTYEDAIITAYRDHCQALARGD
TPYRVLAEMLQKKTGSSSGKGGSMHYYNSKNNFYGGNGIVGAQLPVGTGLAFALKYQNKP
NVAVAMYGDGAANQGQIYEAANMAALWKLPILYVCENNLYGMGTSNDRASHNTKFYTRGD
LIPGFKIDGQNILVVREAMRFAKKWCVAGKGPLFIEFLTYRYHGHSMSDPGITYRTREEI
NEVRAKRDPIEIVRKLLLENSWAAEAELKDIEKKIRADIEADVEKMKSDPEPTFEDLYAH
VGTDKHYIRGVEYKLSQLEY