Identifiers and Description

Gene Model Identifier

Contig9047.0.g96

Standard Name

None

Aliases

Contig9047_0_g96

Description

Myosin head (motor domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR326W8.998727740297757e-142MYO2 SGDID:S000005853, Chr XV
from 925721-930445, Genom...
T. thermophilaTTHERM_004233704.99876080819921e-108myosin

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9047.0.g96(coding)
ATGGAATCAAACAGCCAGAATTTATTTTGGATAGTAGACCACGAGGAATTGTGCTGGGCT
CCAGGCAAGTTTGTTAGAGATGCTGGAAATGAAATACATGTGTAATGTATTGATGACGAT
TAATATTATTCAATTGAAAAACCTGTCTTGGAAGTTCATCCCTCTTGCTTAGAGGGAGTA
TCAGACTTGCTTATGCTTGGAGATTTCAATGAAGGTGCACTTTTACATACTATAAGATAA
AGATTTAAACAATAAAATATTTTTACTTCAATTGGTACACCTATTCTGATATCAGTCAAT
CCCTTCTAAAAGCTAAAAATATTCACTACTTTTATTGCCAGAAAGTACCGTAAATACTCT
AATGCTGTGAGAGCTGGAAATGAAAATTCTGTAGAAAAGCCCTAACCACATTTATTTATG
GTAGCTGAAGATTCATTCTAAGATATGCTTATGTACAAGAAGAACTAGTGTATTATTATA
TCAGGGGAGAGTGGTGCTGGTAAAACAGAAGCCACAAAGATTGTCTTGAAATATTTAGCT
TAGGCAAATACAAACTTTGTGTCTGAAAAAGATATGGACATGATGGATGTGAAAGCTTAC
ATTGGAGAGGATAAACATAGCATTGAGAGATAAGTTTTGGATTCAAACCCTTTACTTGAA
GCATTTGGAAATGCAAAGACAAATAGAAATAATAATTCTTCAAGATTCGGTAAATTTATC
AGAGTAAATTTTGAGCCTAGTGGTAAAATTCACTCAGCCACTATAATTAACTATCTCCTT
GAAAAATCTAGAATAGTCTTTTAGTAGACAAATGAAAGAAACTATCACATTTTCTATCAA
ATTATGGCTTCATAAAGCATAAAAGAATAGTATAAACTAGGGGATATTGATAGCTATTAT
TATCTTAATTAGTCAGGAGTTTTTACTGTTAACGGAATTGATGATGGAGAGGACTTCAAA
ATTACATTGGATTGTATGAAAAATATAGGATTCTCAGATGAAGAAATCAATTATGTATTA
GATATAATTGTTGGTGTACTACTTTTGGGTGAAGTTAATTTTGATAAAGTAGCAAAGGCT
GGAGTTGGAGATATTTCTTAAATAGTTCCTGAATCTATGCCATTAGTTGAGTAAATTTGT
GAATTATTGCAGTTAGACCTTCATAAACTCATAAAATGCCTGACTATGAGAACTTTACAA
GTAGGCAAAGAGGTAATTGAAAGCAATTAATAAAGAGAGGAATCTTACAATTCAAGAGAT
GCCATGGCCAAATCAGTTTATGGTAATTTATTCAACTGGATAGTATAGCGTATTAACTAA
TCAATCTCAGAGAAAATGAATGCATAATCATCTAAAAACTAGAAATTTATCGGCATCTTA
GATATCTTTGGATTTGAAATATTTGAAGCTAATTCTTTCGAATAACTGTGCATTAATTAC
GCTAATGAAGTACTCCAACAACATTTTAATCATCATATGTTTAACTTAGAACAGGAGGAG
TACAAATAAGAAAACATTCAATGGAGTTAAATAAAGTTTGTTGATAACTAGCAGTGCATT
GACTTGATAGAGTCCATTCAAAAGCCTAGTGTTTTTAAGTTGCTGGAAGAAGAGACCATG
ATGAAGAGTACGGACCTTAAATTACTAAGAAAAATGAATGATATGCTAACTGTTAATAAG
TCATTCAAAAGACCTAACAGATTCGACTGTGCTGAATTTATTATTTGTCATTATGCTGGA
GAAGTAGAATACAAAGTCAGCAGTTTCATCGAAAAAAATAAAGATTAAGTAGGTGATCTT
ATAAGAGATACACTTTCACAATCAAAAAGCTAACTCCAAGAACTTATGAAAATATTGAAC
GAATCATCTCCGAGATATATTAGATGCATAAAGCCTAATCATTAATTCTCTCCTATCATA
TTTGATTCTGTTGAGGTTTGTAAGTAACTTAGATGTGCTGGTATGCTAGAAGCAATTAGA
ATCAGGAAGGCAGGTTATGCAATAAGAGTAACTTAAGATGATTTTGCAAAACGTTATAGA
GCAGTTCTTGGGAAGAAAAAAATAAATTAGCTTATAAAATCTTCAGATAATTCTTAAAAC
TTGAATAAAACCCTCTGTGAAATGATTTTTAAGGAAGTTTAATAATATGCCTAAAATAAG
AAGATTCTTGACCCAGAAATGAAAATGTGGTAGGTTGGTGTAACTAAGATTTTTATGAAG
GAAGATGTCAGAACTGCTCTCGAATCAGCAATGGGACTTGCAGTGCTAGACTAAGCTAAA
CAGATATAAAAGTTATTTAGGGGGTTCAAAGCCAGAAAACTGTTTAGAAAAATGCTTAAT
GCTGATAAAATTATTAAGAGACACATTAAGAAATACGTCATCAGAAGAAGATTTAGAAAA
GTTGTTTAAAAGTTCATTCATAACATGAAGATTAGAATAGTAAAAATCTAAAAATTATTT
AAGAAAATATATAGAAAAAAGCAGATTCTATTAGAAATAAATAAAAGAATTATAATTAAA
AAGGATAAAGAGAGAGCAGAATAACTTCGAAAAGCAGAGCTTGAACGAGTTAGATAGATT
CAAGAATAATAAAAATAAAACCAATAATAGCAGTAATAAAATTCATAATAAAACAATTCC
TTGACTTCAATTAGAGATGGAGACAACAACCAAGAAACTAAAAATTAAACAAACAATAAT
TAGTAATAGTAGCTGTTGCAGCAAAACAGATTTCAAAGCAACATAGATAAATTGACAACC
TCGTCATCAATCGATTACTACCAAGATTTGTCTACTATGGAATCATTAAAGAAACAGTTA
AAGTAAATGAGTGAGGAAAATGATTCATTAAAACAGCAGAATAAGCAGCTTAAGAGCGAA
GGAGAAGAGAAAGACAGAAAGATTAAAGAGTTAAATATAAGATTAGATATTTCAAGGAAA
TAGTAATAAAACACCAGTGGAAGTGGTTAAAAGACATCAGCTAATGATTTTGAGTCACTA
CTCAACAATCAAGACCTATCTTTCATTACATCAATAGATGAGAAAGGCAATACTTTATTA
AATAGAGGTTCTGTGAAAGGTTTCTAAATTCCTCATTAAAATGTGGGGTAATCATCAATC
AACGAAGCTCTAGAACAAAAAGAGGAGGAGATACAATCGCTTAAAAACAAATTAGAAATT
GTTCAGATGGAAGCCACGTTTAAGGATAGTTAATTTGAATAGTTGAAGGAGGAAAATGAA
TAACTGGGGGAAAAAGCTAAGAAATGGAGGACTAATCTAGATTAAGAAATAGAGAAGAAT
TCTAAAACAGTTCAAAACTTGACACAGTAAGTCAAAGATCTTCAAGAAAAGAATTATCGT
CTGTAAGTTGAATCTAATCAACGATCAATGGAAAACGAAAAGCGGGTATTCAAGGATCAG
TCAGAAGAAATAAAGCGTTTAGAATCTCAAATCAGAGAAAAGTCAGACCAACTCGATGAG
TTGGAGTTAGAGTCATTCAACATGAAATAGAAACACTCCGAGGAGATTGCAAAACTCACC
TATGATTTGGAGTTTATTAAGAAGAAATACAGAGAGCTTGAAAGTGAGTAGTAGGAATTC
ATGATTAAATACGATAGACTTGAAGAGAAATACATTGAGAAAGATGAAATGATGAAACGC
TATGAGGAGGAAAATCTATCACTAGGGGAGACATGCAAGATCCTACAGAATTAACTTGAA
GACTTTGGGGATAATTAAAACAGCATGATTGGATAAATGAATAATGAAAGACAGTTCTCA
TCATAGACACAGAACAAACTCAAAGAACTGAATAGAGAAATTGATAGACTTAAATCTGCT
TTAGGAATAAAAGAGGCAGAAAATAAGATACTTAAGGAGTAACTTGATAGGGAGAAGAAG
AAGAGAAAAGAGGCAGAGGATGACATGGACGAGAAAATTGAAATGAATTAAGAGCTTAAG
AAGCAAGTCTCTAATTTAGAGAGCTAATTACTATTTGGTGGTAACTCTACCAATGAAGAA
CGTATTGAATTTGAGAAGCAGAAAATGAGAGAAAAACTGGAGGAACTACTGACTCAGTAA
GTTTTGGATTAGGAACAAATAGAGACACTTAACAGAGAAAATGAGTTCTACAATCAAATA
ATTACTTTGTTCTTGACCATTCAAAAAGTGAGTGACAAGGAGAAGAAGTATTGCTACATG
ATGGCATCAGAAACTGATATACTCAAGAAAAGTTAACTCATGGAAGCGATCAGTTAATGT
GGGGATAAAGCTAAGTAATTAGATGATAAATTGAGAAAAATACTCAGGCAAGTTAGGAAG
AATTAGTGA


>Contig9047.0.g96(protein)
MESNSQNLFWIVDHEELCWAPGKFVRDAGNEIHVQCIDDDQYYSIEKPVLEVHPSCLEGV
SDLLMLGDFNEGALLHTIRQRFKQQNIFTSIGTPILISVNPFQKLKIFTTFIARKYRKYS
NAVRAGNENSVEKPQPHLFMVAEDSFQDMLMYKKNQCIIISGESGAGKTEATKIVLKYLA
QANTNFVSEKDMDMMDVKAYIGEDKHSIERQVLDSNPLLEAFGNAKTNRNNNSSRFGKFI
RVNFEPSGKIHSATIINYLLEKSRIVFQQTNERNYHIFYQIMASQSIKEQYKLGDIDSYY
YLNQSGVFTVNGIDDGEDFKITLDCMKNIGFSDEEINYVLDIIVGVLLLGEVNFDKVAKA
GVGDISQIVPESMPLVEQICELLQLDLHKLIKCLTMRTLQVGKEVIESNQQREESYNSRD
AMAKSVYGNLFNWIVQRINQSISEKMNAQSSKNQKFIGILDIFGFEIFEANSFEQLCINY
ANEVLQQHFNHHMFNLEQEEYKQENIQWSQIKFVDNQQCIDLIESIQKPSVFKLLEEETM
MKSTDLKLLRKMNDMLTVNKSFKRPNRFDCAEFIICHYAGEVEYKVSSFIEKNKDQVGDL
IRDTLSQSKSQLQELMKILNESSPRYIRCIKPNHQFSPIIFDSVEVCKQLRCAGMLEAIR
IRKAGYAIRVTQDDFAKRYRAVLGKKKINQLIKSSDNSQNLNKTLCEMIFKEVQQYAQNK
KILDPEMKMWQVGVTKIFMKEDVRTALESAMGLAVLDQAKQIQKLFRGFKARKLFRKMLN
ADKIIKRHIKKYVIRRRFRKVVQKFIHNMKIRIVKIQKLFKKIYRKKQILLEINKRIIIK
KDKERAEQLRKAELERVRQIQEQQKQNQQQQQQNSQQNNSLTSIRDGDNNQETKNQTNNN
QQQQLLQQNRFQSNIDKLTTSSSIDYYQDLSTMESLKKQLKQMSEENDSLKQQNKQLKSE
GEEKDRKIKELNIRLDISRKQQQNTSGSGQKTSANDFESLLNNQDLSFITSIDEKGNTLL
NRGSVKGFQIPHQNVGQSSINEALEQKEEEIQSLKNKLEIVQMEATFKDSQFEQLKEENE
QLGEKAKKWRTNLDQEIEKNSKTVQNLTQQVKDLQEKNYRLQVESNQRSMENEKRVFKDQ
SEEIKRLESQIREKSDQLDELELESFNMKQKHSEEIAKLTYDLEFIKKKYRELESEQQEF
MIKYDRLEEKYIEKDEMMKRYEEENLSLGETCKILQNQLEDFGDNQNSMIGQMNNERQFS
SQTQNKLKELNREIDRLKSALGIKEAENKILKEQLDREKKKRKEAEDDMDEKIEMNQELK
KQVSNLESQLLFGGNSTNEERIEFEKQKMREKLEELLTQQVLDQEQIETLNRENEFYNQI
ITLFLTIQKVSDKEKKYCYMMASETDILKKSQLMEAISQCGDKAKQLDDKLRKILRQVRK
NQ